Latexin Protein, Mouse (His)
Based on 1 Customer Validation
Latexin protein, possessing notable properties, highly potently inhibits CPA1, CPA2, and CPA4 enzymes in a hardly reversible, non-competitive manner.Its potential role in inflammation regulation is suggested.Latexin Protein, Mouse (His) is the recombinant mouse-derived Latexin protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Latexin protein, possessing notable properties, highly potently inhibits CPA1, CPA2, and CPA4 enzymes in a hardly reversible, non-competitive manner.Its potential role in inflammation regulation is suggested.Latexin Protein, Mouse (His) is the recombinant mouse-derived Latexin protein, expressed by E.coli , with N-His labeled tag.
Background
Latexin, a protein with notable properties, acts as a highly potent inhibitor of CPA1, CPA2, and CPA4 enzymes in a hardly reversible, non-competitive manner. Additionally, it is suggested to potentially play a role in the regulation of inflammation.
Verified Bioactivity
Measured by its ability to inhibit carboxypeptidase A1 cleavage of the colorimetric peptide substrate Ac-Phe-Thiaphe-OH in the presence of 5,5’Dithio-bis (2-nitrobenzoic acid) (DTNB). The IC50 value is 0.555 nM, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by Trypsin for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P70202 (E2-E222)
-
Molecular Construction
-
N-term
-
His
-
Latexin (E2-E222)
Accession # P70202 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LXN; ECI; Latexin; TCI; Endogenous Carboxypeptidase Inhibitor; Protein MUM; Tissue Carboxypeptidase Inhibitor; MUM
-
AA Sequence
EIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 300 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)