1. Recombinant Proteins
  2. Receptor Proteins
  3. Leukocyte Immunoglobin-like Receptors
  4. LILRA2
  5. LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His)

LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His)

Cat. No.: HY-P704760
Handling Instructions Technical Support

The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293, with C-His labeled tag.

Background

LILRA2/CD85h/ILT1 protein plays a crucial role in innate immune responses against microbial infection. It specifically recognizes a subset of N-terminally truncated immunoglobulins resulting from protease cleavage in various pathogenic bacteria and fungi, including L. pneumophila, M. hyorhinis, S. pneumoniae, S. aureus, and C. albicans. The protein binds to epitopes located partly in the variable region of immunoglobulin light chains, requiring the constant region for signaling. LILRA2 interacts with cleaved IgM, IgG3, and IgG4 but does not bind to cleaved IgA1. Activation through the binding of N-terminally truncated immunoglobulins triggers neutrophil activation, leading to the release of various cytokines and chemokines. In monocytes, this activation induces the release of CSF2, CF3, IL6, CXCL8, and CCL3, while down-regulating responses to bacterial lipopolysaccharide (LPS), potentially through the down-regulation of TLR4 expression. Additionally, in eosinophils, ligand binding results in the release of RNASE2, IL4, and leukotriene C4. Importantly, LILRA2 does not bind to class I MHC antigens and exists as a homodimer.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8N149-1 (G24-N449)

Gene ID

11027

Molecular Construction
N-term
LILRA2 (G24-N449)
Accession # Q8N149-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2; CD85 Antigen-Like Family Member H; Immunoglobulin-Like Transcript 1; ILT-1; Leukocyte Immunoglobulin-Like Receptor 7; LIR-7; CD85h; LILRA2; ILT1; LIR7
AA Sequence

GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN

Predicted Molecular Mass
48.8 kDa.
Molecular Weight

Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRA2/CD85h/ILT1 Protein, Human (426a.a, HEK293, His)
Cat. No.:
HY-P704760
Quantity:
MCE Japan Authorized Agent: