LILRA6/CD85b/ILT-8 Protein, Human (HEK293, His-Avi)

LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRA6/CD85b/ILT-8 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

LILRA6/CD85b/ILT-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and regulation. Its ability to interact with class I MHC molecules indicates its involvement in monitoring and potentially modulating immune responses. As a receptor, LILRA6 may contribute to the precise recognition of cells presenting class I MHC antigens, thereby influencing immune activities. Further exploration of LILRA6's interactions and its impact on immune signaling could deepen our understanding of its role as a receptor and its potential implications in immune surveillance and regulatory mechanisms.

Human

HEK293

C-Avi;C-8*His

Q6PI73-1 (G24-N447)

79168  [NCBI]

Extracellular Domain

GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN

Approximately 65-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.