LILRA6/CD85b/ILT-8 Protein, Human (HEK293, His-Avi)
LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRA6/CD85b/ILT-8 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRA6/CD85b/ILT-8 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
Background
LILRA6/CD85b/ILT-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and regulation. Its ability to interact with class I MHC molecules indicates its involvement in monitoring and potentially modulating immune responses. As a receptor, LILRA6 may contribute to the precise recognition of cells presenting class I MHC antigens, thereby influencing immune activities. Further exploration of LILRA6's interactions and its impact on immune signaling could deepen our understanding of its role as a receptor and its potential implications in immune surveillance and regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q6PI73-1 (G24-N447)
-
Molecular Construction
-
N-term
-
LILRA6 (G24-N447)
Accession # Q6PI73-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LILRA6; Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 6; Prev. LILRB6; Leucocyte Ig-Like Receptor A6; ILT8; Leukocyte Ig-Like Receptor; CD85b; ILT-8; Leukocyte Immunoglobulin-Like Receptor, Subfamily B (With TM And ITIM Domains), Member 6; Imm
-
AA Sequence
GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
-
Predicted Molecular Mass
49.2 kDa
-
Molecular Weight
Approximately 65-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
