1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85j/LIR-1
  5. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

Cat. No.: HY-P700778
Handling Instructions Technical Support

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The LILRB1/CD85j/ILT2 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. Additionally, it acts as a receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding induces inhibitory signals, leading to the down-regulation of the immune response. The engagement of LILRB1 by class I MHC molecules on natural killer cells or T-cells protects target cells from lysis, and interaction with HLA-B or HLA-E inhibits FCER1A signaling and serotonin release. Moreover, LILRB1 inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. It recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, triggering the secretion of growth-promoting factors by decidual NK cells. Additionally, it reprograms B cells toward an immune suppressive phenotype. LILRB1 binds PTPN6 when phosphorylated and interacts with FCER1A, FCGR1A, and the UL18 protein from human cytomegalovirus. It also interacts with peptide-bound HLA-G-B2M and HLA-F-B2M complexes, highlighting its diverse roles in immune modulation and viral recognition.

Species

Rhesus Macaque

Source

HEK293

Tag

C-8*His

Accession

NP_001035762.2 (M1-H474)

Gene ID
Molecular Construction
N-term
LILRB1 (M1-H474)
Accession # NP_001035762.2
8*His
C-term
Protein Length

Partial

Synonyms
ILT2; ILT-2; ILT2FLJ37515; LILRB1; LIR1; MIR7; CD85J; XXbac-BCX85G21.4
AA Sequence

MHRGLIHPQSRAVGGDTMTPILTILICLGLSLGSRTRVQEGILPKPTLWAEPGSMISEGSPVTLRCQGSLQVQDYCLYREKKPASWVRQIRQELVKKGYFAIGFITWEHTGQYRCQYYNHSWWSEPSDPLELVVIGAYSKPTLSALPSPVVASGRNVTLQCDSQVAFDGFILCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPSHRWSYRCYGYISSDPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVARGDKLTLQCGSDAGYDRFALYKEGEGDFLQRPGQQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSPEWSAPSDPLDILISRQIRGRPFLSVQPGPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMHKYPKYQAEFPISPVTSAHAGTYRCYGSRSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSAPQSGLGRH

Predicted Molecular Mass
48.1 kDa
Molecular Weight

Approximately 65-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)
Cat. No.:
HY-P700778
Quantity:
MCE Japan Authorized Agent: