LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The LILRB1/CD85j/ILT2 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. Additionally, it acts as a receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding induces inhibitory signals, leading to the down-regulation of the immune response. The engagement of LILRB1 by class I MHC molecules on natural killer cells or T-cells protects target cells from lysis, and interaction with HLA-B or HLA-E inhibits FCER1A signaling and serotonin release. Moreover, LILRB1 inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. It recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, triggering the secretion of growth-promoting factors by decidual NK cells. Additionally, it reprograms B cells toward an immune suppressive phenotype. LILRB1 binds PTPN6 when phosphorylated and interacts with FCER1A, FCGR1A, and the UL18 protein from human cytomegalovirus. It also interacts with peptide-bound HLA-G-B2M and HLA-F-B2M complexes, highlighting its diverse roles in immune modulation and viral recognition.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LILRB1 (M1-H474)
      Accession # NP_001035762.2
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LILRB1; CD85 Antigen-Like Family Member J; Leukocyte Immunoglobulin Like Receptor B1; Myeloid Inhibitory Receptor 7; LIR-1; Leucocyte Ig-Like Receptor B1; MIR-7; ILT-2; ILT2; CD85; LIR1; MIR7; CD85j; Immunoglobulin Heavy Chain Variable Region; PIR-B; Leuk

  • AA Sequence

    MHRGLIHPQSRAVGGDTMTPILTILICLGLSLGSRTRVQEGILPKPTLWAEPGSMISEGSPVTLRCQGSLQVQDYCLYREKKPASWVRQIRQELVKKGYFAIGFITWEHTGQYRCQYYNHSWWSEPSDPLELVVIGAYSKPTLSALPSPVVASGRNVTLQCDSQVAFDGFILCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPSHRWSYRCYGYISSDPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVARGDKLTLQCGSDAGYDRFALYKEGEGDFLQRPGQQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSPEWSAPSDPLDILISRQIRGRPFLSVQPGPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMHKYPKYQAEFPISPVTSAHAGTYRCYGSRSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSAPQSGLGRH

  • Predicted Molecular Mass

    48.1 kDa

  • Molecular Weight

    Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00