1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85j/LIR-1
  5. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

Cat. No.: HY-P700778
Handling Instructions Technical Support

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The LILRB1/CD85j/ILT2 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. Additionally, it acts as a receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding induces inhibitory signals, leading to the down-regulation of the immune response. The engagement of LILRB1 by class I MHC molecules on natural killer cells or T-cells protects target cells from lysis, and interaction with HLA-B or HLA-E inhibits FCER1A signaling and serotonin release. Moreover, LILRB1 inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. It recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, triggering the secretion of growth-promoting factors by decidual NK cells. Additionally, it reprograms B cells toward an immune suppressive phenotype. LILRB1 binds PTPN6 when phosphorylated and interacts with FCER1A, FCGR1A, and the UL18 protein from human cytomegalovirus. It also interacts with peptide-bound HLA-G-B2M and HLA-F-B2M complexes, highlighting its diverse roles in immune modulation and viral recognition.

Species

Rhesus Macaque

Source

HEK293

Tag

C-8*His

Accession

NP_001035762.2 (M1-H474)

Gene ID
Molecular Construction
N-term
LILRB1 (M1-H474)
Accession # NP_001035762.2
8*His
C-term
Protein Length

Partial

Synonyms
ILT2; ILT-2; ILT2FLJ37515; LILRB1; LIR1; MIR7; CD85J; XXbac-BCX85G21.4
AA Sequence

MHRGLIHPQSRAVGGDTMTPILTILICLGLSLGSRTRVQEGILPKPTLWAEPGSMISEGSPVTLRCQGSLQVQDYCLYREKKPASWVRQIRQELVKKGYFAIGFITWEHTGQYRCQYYNHSWWSEPSDPLELVVIGAYSKPTLSALPSPVVASGRNVTLQCDSQVAFDGFILCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPSHRWSYRCYGYISSDPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVARGDKLTLQCGSDAGYDRFALYKEGEGDFLQRPGQQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSPEWSAPSDPLDILISRQIRGRPFLSVQPGPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMHKYPKYQAEFPISPVTSAHAGTYRCYGSRSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSAPQSGLGRH

Predicted Molecular Mass
48.1 kDa
분자량

Approximately 65-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
LILRB1/CD85j/ILT2 Protein, Rhesus macaque (474a.a, HEK293, His)
Cat. No.:
HY-P700778
수량:
MCE Japan Authorized Agent: