LILRB2/CD85d/ILT-4 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LILRB2/CD85d/ILT-4 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 425 a.a., with molecular weight of 65-70 kDa.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LILRB2/CD85d/ILT-4 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 425 a.a., with molecular weight of 65-70 kDa.
Background
The LILRB2/CD85d/ILT-4 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. It plays a crucial role in immune response down-regulation and the establishment of tolerance. Specifically, it recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, leading to the differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, crucial for maintaining maternal-fetal tolerance. LILRB2 competes with CD8A for binding to class I MHC antigens and inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. Moreover, it interacts with PTPN6 when phosphorylated and binds to FCGR1A. The direct interactions with peptide-bound HLA-G-B2M and HLA-F-B2M further highlight its involvement in immune modulation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
BAE87348 (G24-L448)
-
Gene ID123570349 [NCBI]
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
LILRB2; Monocyte/Macrophage Immunoglobulin-Like Receptor 10; Leukocyte Immunoglobulin Like Receptor B2; CD85 Antigen-Like Family Member D; MIR-10; Myeloid Inhibitory Receptor 10; LIR-2; Leucocyte Ig-Like Receptor B2; MIR10; ILT-4; ILT4; Leukocyte Immunoglobulin-Like Receptor 2; LIR2; Immunoglobulin-Like Transcript 4; Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2; Ig-Like Transcript 4; CD85d; CD85d Antigen; Leukocyte Immunoglobulin-Like Receptor, Subfamily B (With TM And ITIM Domains), Member 2
-
AA Sequence
GTLPKPMLWAEPGSMISEGSPVTLRCQGSLQVQEYRLYKGKKPASWVRRIQQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVTFDGFVLCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSHSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCGSDVGYDRFALYKEGERDFLQRPSRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILISGQIRGTPFLSVQPGPTVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAELSMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGAVDTLGLSQNNSETKTASHSQDYTVENL
-
Predicted Molecular Mass
50.2 kDa
-
Molecular Weight
Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
