1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85a/ILT-5
  5. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His-Avi)

LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78171
Handling Instructions Technical Support

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

LILRB3/CD85a Protein appears to function as a receptor for class I MHC antigens, highlighting its integral role in immune recognition. Activation of LILRB3 is triggered upon coligation with immune receptors like FCGR2B and the B-cell receptor. This activation leads to the down-regulation of antigen-induced B-cell activation through the recruitment of phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). The protein further interacts with key signaling molecules including LYN, PTPN6/SHP-1, and PTPN11/SHP-2, emphasizing its involvement in intricate signaling cascades that regulate immune responses. A comprehensive exploration of LILRB3's interactions and its modulation of immune receptor activities could enhance our understanding of its function and potential implications in the fine-tuning of B-cell activation and immune regulation.

Biological Activity

Immobilized Biotinylated Human LILRB3, His Tag at 2 μg/ml (100 μl/well) on the streptavidin precoated plate (5 μg/ml). Dose response curve for Anti-LILRB3 Antibody, hFc Tag with the EC50 of 5.4 ng/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

O75022 (G24-E443)

Gene ID

102725035  [NCBI]

Molecular Construction
N-term
LILRB3 (G24-E443)
Accession # O75022
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD85a; ILT5; ILT-5; LILRB3; LIR3; LIR3CD85A; LIR-3MGC138403; PIRB; HL9
AA Sequence

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Predicted Molecular Mass
50 kDa
Molecular Weight

Approximately 60-72 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78171
Quantity:
MCE Japan Authorized Agent: