LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His)
LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.
Background
LILRB3/CD85a Protein appears to function as a receptor for class I MHC antigens, highlighting its integral role in immune recognition. Activation of LILRB3 is triggered upon coligation with immune receptors like FCGR2B and the B-cell receptor. This activation leads to the down-regulation of antigen-induced B-cell activation through the recruitment of phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). The protein further interacts with key signaling molecules including LYN, PTPN6/SHP-1, and PTPN11/SHP-2, emphasizing its involvement in intricate signaling cascades that regulate immune responses. A comprehensive exploration of LILRB3's interactions and its modulation of immune receptor activities could enhance our understanding of its function and potential implications in the fine-tuning of B-cell activation and immune regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
O75022 (G24-E443)
-
Gene ID102725035 [NCBI]
-
Molecular Construction
-
N-term
-
LILRB3 (G24-E443)
Accession # O75022 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
LILRB3; Leukocyte Immunoglobulin-Like Receptor, Subfamily B (With TM And ITIM Domains), Member 3; Leukocyte Immunoglobulin Like Receptor B3; Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3; LIR-3; CD85 Antigen-Like Family Member A; ILT5; Immun
-
AA Sequence
GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE
-
Predicted Molecular Mass
47.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)