LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

LILRB3/CD85a Protein appears to function as a receptor for class I MHC antigens, highlighting its integral role in immune recognition. Activation of LILRB3 is triggered upon coligation with immune receptors like FCGR2B and the B-cell receptor. This activation leads to the down-regulation of antigen-induced B-cell activation through the recruitment of phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). The protein further interacts with key signaling molecules including LYN, PTPN6/SHP-1, and PTPN11/SHP-2, emphasizing its involvement in intricate signaling cascades that regulate immune responses. A comprehensive exploration of LILRB3's interactions and its modulation of immune receptor activities could enhance our understanding of its function and potential implications in the fine-tuning of B-cell activation and immune regulation.

Human

HEK293

C-His

O75022 (G24-E443)

102725035  [NCBI]

Partial

Biotin

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.