1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85a/ILT-5
  5. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His)

LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His)

Cat. No.: HY-P75913
Handling Instructions Technical Support

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

Background

LILRB3/CD85a Protein appears to function as a receptor for class I MHC antigens, highlighting its integral role in immune recognition. Activation of LILRB3 is triggered upon coligation with immune receptors like FCGR2B and the B-cell receptor. This activation leads to the down-regulation of antigen-induced B-cell activation through the recruitment of phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). The protein further interacts with key signaling molecules including LYN, PTPN6/SHP-1, and PTPN11/SHP-2, emphasizing its involvement in intricate signaling cascades that regulate immune responses. A comprehensive exploration of LILRB3's interactions and its modulation of immune receptor activities could enhance our understanding of its function and potential implications in the fine-tuning of B-cell activation and immune regulation.

Species

Human

Source

HEK293

Tag

C-His

Accession

O75022 (G24-E443)

Gene ID

102725035  [NCBI]

Molecular Construction
N-term
LILRB3 (G24-E443)
Accession # O75022
His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Leukocyte immunoglobulin-like receptor subfamily B member 3; LIR-3; ILT-5; CD85a
AA Sequence

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Predicted Molecular Mass
47.6 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
LILRB3/CD85a Protein, Human (Biotinylated, HEK293, His)
Cat. No.:
HY-P75913
수량:
MCE Japan Authorized Agent: