Copy Link Print Information

LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-His labeled tag.

Background

LILRB4/CD85k/ILT3, an inhibitory receptor intricately involved in immune regulation, plays a crucial role in down-regulating immune responses. It serves as a receptor for FN1 and integrin ITGAV/ITGB3, exerting inhibitory effects on IgE-mediated mast cell activation and KITLG/SCF-mediated mast cell activation. Through its interaction with ITGAV/ITGB3, LILRB4/ILT3 further inhibits antibody production by memory and marginal zone B cells, likely by suppressing their differentiation into plasma cells. This multifaceted receptor extends its inhibitory influence to diverse immune functions, such as suppressing IFNG production by CD8 T cells, CD4 T cells, and natural killer cells, as well as inhibiting antigen presentation by dendritic cells to T cells, preventing T cell activation. Additionally, LILRB4/ILT3 effectively inhibits lipopolysaccharide-mediated neutrophil-dependent vascular injury and contributes to the suppression of the allergic inflammatory response by impeding the infiltration of neutrophils and eosinophils while preventing mast cell degranulation. Its interactions, particularly when tyrosine phosphorylated, with SH2 domain-containing phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 enhance the inhibition of mast cell activation.

Verified Bioactivity

Immobilized Cynomolgus LILRB4,His Tag at 5 ug/mL(100 μL/well) on the plate. Dose response curve for Anti-LILRB4 Antibody,hFc Tag with the EC50 of 0.13-0.38 μg/mL determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession

    XP_015297198.1 (Q22-E259)

  • Gene ID
    107128256  [NCBI]
  • Molecular Construction
    • N-term
    • LILRB4 (Q22-E259)
      Accession # XP_015297198.1
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LILRB4; CD85 Antigen-Like Family Member K; Leukocyte Immunoglobulin Like Receptor B4; Monocyte Inhibitory Receptor HM18; LIR-5; Immunoglobulin-Like Transcript 3; ILT3; Leucocyte Ig-Like Receptor B4; LIR5; ILT-3; CD85k; HM18; Leukocyte Immunoglobulin-Like

  • AA Sequence

    QAGPLPKPTVWAEPGSVISWGSPVTIWCQGTLDAQEYHLDKEGSPAPWDTQNPLEPRNKAKFSIPSMTQHYAGRYRCYYHSHPDWSEDSDPLDLVMTGAYSKPILSVLPSPLVTSGESVTLLCQSQSPMDTFLLFKEGAAHPLPRLRSQHGAQLHWAEFPMGPVTSVHGGTYRCISSRSFSHYLLSRPSDPVELTVLGSLESPSPSPTRSISAAAGPEDQSLMPTGSDPQSGLRRHWE

  • Predicted Molecular Mass

    27.2 kDa

  • Molecular Weight

    Approximately 34-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • LILRB4/CD85k/ILT3 Protein, Cynomolgus (HEK293, His) Product Image