LOX Protein, Human (sf9, His, MBP)
LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (sf9, His, MBP) is the recombinant human-derived LOX protein, expressed by Sf9 insect cells, with C-6*His and N-MBP labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (sf9, His, MBP) is the recombinant human-derived LOX protein, expressed by Sf9 insect cells, with C-6*His and N-MBP labeled tag.
Background
The LOX protein assumes a pivotal role in the post-translational oxidative deamination of peptidyl lysine residues within precursors to fibrous collagen and elastin, as highlighted by its involvement in the modification of these structural proteins. Acting as a regulator of Ras expression, LOX also exhibits potential implications in tumor suppression, suggesting a multifaceted role in cellular homeostasis and cancer-related processes. Additionally, the protein is implicated in shaping the architecture of the aortic wall, contributing to the structural integrity and function of this crucial vascular component. The diverse functions of LOX underscore its significance in extracellular matrix dynamics, Ras regulation, and potential tumor suppressive mechanisms, making it a key player in cellular and tissue homeostasis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-6*His;N-MBP
-
Accession
P28300 (D169-Y417)
-
Gene ID4015
-
Molecular Construction
-
N-term
-
MBP
-
LOX (D169-Y417)
Accession # P28300 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LOX; Lysyl Oxidase Homolog; Lysyl Oxidase; AAT10; Protein-Lysine 6-Oxidase
-
AA Sequence
DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
-
Predicted Molecular Mass
73 kDa
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
