LOX Protein, Human (C-His)
Based on 1 Customer Validation
LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.
Background
The LOX protein assumes a pivotal role in the post-translational oxidative deamination of peptidyl lysine residues within precursors to fibrous collagen and elastin, as highlighted by its involvement in the modification of these structural proteins. Acting as a regulator of Ras expression, LOX also exhibits potential implications in tumor suppression, suggesting a multifaceted role in cellular homeostasis and cancer-related processes. Additionally, the protein is implicated in shaping the architecture of the aortic wall, contributing to the structural integrity and function of this crucial vascular component. The diverse functions of LOX underscore its significance in extracellular matrix dynamics, Ras regulation, and potential tumor suppressive mechanisms, making it a key player in cellular and tissue homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P28300 (P174-Y417)
-
Gene ID4015
-
Molecular Construction
-
N-term
-
LOX (P174-Y417)
Accession # P28300 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LOX; Lysyl Oxidase Homolog; Lysyl Oxidase; AAT10; Protein-Lysine 6-Oxidase
-
AA Sequence
PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
-
Predicted Molecular Mass
35.3 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
