LOXL4 Protein, Human (His)
Based on 1 Customer Validation
LOXL4 Protein, Human (His) is the recombinant human-derived LOXL4, expressed by E. coli , with C-6*His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
LOXL4 Protein, Human (His) is the recombinant human-derived LOXL4, expressed by E. coli , with C-6*His labeled tag. ,
Background
LOXL4 is an enzyme that catalyzes the oxidative deamination of lysine and hydroxylysine residues in collagen and elastin, leading to the formation of covalent cross-linkages and the stabilization of collagen and elastin fibers.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q96JB6 (D570-I756)
-
Gene ID84171
-
Molecular Construction
-
N-term
-
LOXL4 (D570-I756)
Accession # Q96JB6 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LOXL4; Lysyl Oxidase Homolog 4; Lysyl Oxidase Like 4; FLJ21889; LOXC; Lysyl Oxidase-Like 4 Pseudogene; Lysyl Oxidase-Related Protein C; Lysyl Oxidase Related C; Lysyl Oxidase-Like Protein 4; Lysyl Oxidase-Like 4
-
AA Sequence
DHMDWPYGYRRLLRFSTQIYNLGRTDFRPKTGRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI
-
Predicted Molecular Mass
23 kDa
-
Molecular Weight
Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 9 mM Na2HPO4/KH2PO4 pH 7.4, 124 mM NaCl, 2.4 mM KCl, pH 7.4, 10% Glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)