1. Recombinant Proteins
  2. Others
  3. LRG1 Protein, Human (HEK293, His)

LRG1 Protein, Human (HEK293, His) is the recombinant human-derived LRG1 protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
250 μg Get quote
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

LRG1 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LRG1 Protein, Human (HEK293, His) is the recombinant human-derived LRG1 protein, expressed by HEK293, with C-6*His labeled tag.

Background

LRG1 is a member of the leucine-rich repeat sequence (LRR) family of proteins involved in protein-protein interactions, signal transduction, and cell adhesion and development. LRG1 is involved in promoting neovascularization (new blood vessel growth) by causing the switching of transforming growth factor β (TGF-β) signaling in endothelial cells. LRG1 binds to the co-receptor endorphins and promotes signaling through the ALK1-Smad1/5/8 pathway. LRG1 is involved in ovarian cancer progression by activating the FAK/AKT signaling pathway[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human Cytochrome c, at 1 μg/mL (100 μL/well) can bind Biotinylated Human LRG1 protein. The ED50 for this effect is 14.13-75.59 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized human Cytochrome c, at 1 μg/mL (100 μL/well) can bind Biotinylated Human LRG1 protein. The ED50 for this effect is 75.59 ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH34389.1 (V36-Q347)

Gene ID
Molecular Construction
N-term
LRG1 (V36-Q347)
Accession # AAH34389.1
6*His
C-term
Protein Length

Partial

Synonyms
rHuLeucine-rich alpha-2-glycoprotein/LRG1, His; Leucine-rich alpha-2-glycoprotein; HMFT1766; LRG; LRG1
AA Sequence

VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 20 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 20 mM NaCl, pH 7.5.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LRG1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LRG1 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LRG1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70166
Quantity:
MCE Japan Authorized Agent: