LRP2/Megalin Protein, Human (282a.a, HEK293, His-StrepII)
Based on 1 Customer Validation
LRP2/Megalin Protein, Human (282a.a, HEK293, His-StrepⅡ) is the recombinant human-derived LRP2/Megalin protein, expressed by HEK293, with C-His and C-StrepⅡ tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
LRP2/Megalin Protein, Human (282a.a, HEK293, His-StrepⅡ) is the recombinant human-derived LRP2/Megalin protein, expressed by HEK293, with C-His and C-StrepⅡ tag.
Background
LRP2/Megalin is a multiligand endocytic receptor (By similarity). It acts together with CUBN to mediate endocytosis of high-density lipoproteins (By similarity) and facilitates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides, and polymyxin B (By similarity). In the kidney, it mediates tubular uptake and clearance of leptin (By similarity) and enables leptin transport across the blood-brain barrier via endocytosis at the choroid plexus epithelium (By similarity). Neuronal endocytosis of leptin is essential for hypothalamic leptin signaling and regulation of feeding and body weight (By similarity). Additionally, it mediates endocytosis and lysosomal degradation of CST3 in kidney proximal tubule cells (By similarity) and facilitates renal uptake of 25-hydroxyvitamin D3 in complex with GC/DBP (By similarity). It also participates in renal uptake of metallothionein-bound heavy metals (PubMed:15126248) and, alongside CUBN, mediates reabsorption of myoglobin (By similarity). LRP2/Megalin contributes to kidney selenium homeostasis by endocytosing selenoprotein SEPP1 (By similarity) and supports renal uptake of the antiapoptotic protein BIRC5/survivin (PubMed:23825075). Furthermore, it mediates renal uptake of MMP2 in complex with TIMP1 (By similarity). During development, it endocytoses Sonic hedgehog protein N-product (ShhN) and facilitates its transcytosis (By similarity). In the embryonic neuroepithelium, it regulates BMP4 endocytic degradation, ensuring proper SHH localization in the ventral neural tube and patterning of the ventral telencephalon (By similarity). In the adult brain, it negatively modulates BMP signaling in the subependymal zone to promote neurogenesis (By similarity) and mediates albumin (ALB) endocytosis in astrocytes, enabling oleic acid synthesis (By similarity). It also influences optic nerve development by supporting SHH-dependent oligodendrocyte precursor cell migration and proliferation (By similarity). In reproductive tissues, it mediates uptake of SHBG-bound androgens and estrogens (By similarity). Additionally, it endocytoses angiotensin-2 and angiotensin 1-7 (By similarity) and promotes lysosomal degradation of CLU/APOJ-bound beta-amyloid protein 40 (By similarity). LRP2/Megalin is crucial for embryonic heart development and normal hearing, potentially through interactions with estrogen in the inner ear (By similarity).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His;C-StrepⅡ
-
Accession
P98164 (E27-S308)
-
Gene ID4036
-
Molecular Construction
-
N-term
-
LRP2 (E27-S308)
Accession # P98164 -
His-StrepⅡ
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
LRP2; LRP-2; LDL Receptor Related Protein 2; Low Density Lipoprotein Receptor-Related Protein II; Megalin; Low Density Lipoprotein Receptor-Related Protein 2; Gp330; Heymann Nephritis Antigen Homolog; Low-Density Lipoprotein Receptor-Related Protein 2; Un
-
AA Sequence
ECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEIGCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQCIPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCTEICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWVCDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTSTGKYCS
-
Predicted Molecular Mass
33.6 kDa
-
Molecular Weight
Approximately 52-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 10 mM HEPES, 150 mM NaCl, 5 mM CaCl2, 0.005% Tween 20, pH 7.4.
<0.1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)