LRP2/Megalin Protein, Human (325a.a, HEK293, His-StrepⅡ)

Customer Review

Based on 1 Customer Validation

LRP2/Megalin Protein, Human (325a.a, HEK293, His-StrepⅡ) is the recombinant human-derived LRP2/Megalin protein, expressed by HEK293, with C-His and C-StrepⅡ tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LRP2/Megalin Protein, Human (325a.a, HEK293, His-StrepⅡ) is the recombinant human-derived LRP2/Megalin protein, expressed by HEK293, with C-His and C-StrepⅡ tag.

Background

LRP2/Megalin is a multiligand endocytic receptor (By similarity). It acts together with CUBN to mediate endocytosis of high-density lipoproteins (By similarity) and facilitates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides, and polymyxin B (By similarity). In the kidney, it mediates tubular uptake and clearance of leptin (By similarity) and enables leptin transport across the blood-brain barrier via endocytosis at the choroid plexus epithelium (By similarity). Neuronal endocytosis of leptin is essential for hypothalamic leptin signaling and regulation of feeding and body weight (By similarity). Additionally, it mediates endocytosis and lysosomal degradation of CST3 in kidney proximal tubule cells (By similarity) and facilitates renal uptake of 25-hydroxyvitamin D3 in complex with GC/DBP (By similarity). It also participates in renal uptake of metallothionein-bound heavy metals (PubMed:15126248) and, alongside CUBN, mediates reabsorption of myoglobin (By similarity). LRP2/Megalin contributes to kidney selenium homeostasis by endocytosing selenoprotein SEPP1 (By similarity) and supports renal uptake of the antiapoptotic protein BIRC5/survivin (PubMed:23825075). Furthermore, it mediates renal uptake of MMP2 in complex with TIMP1 (By similarity). During development, it endocytoses Sonic hedgehog protein N-product (ShhN) and facilitates its transcytosis (By similarity). In the embryonic neuroepithelium, it regulates BMP4 endocytic degradation, ensuring proper SHH localization in the ventral neural tube and patterning of the ventral telencephalon (By similarity). In the adult brain, it negatively modulates BMP signaling in the subependymal zone to promote neurogenesis (By similarity) and mediates albumin (ALB) endocytosis in astrocytes, enabling oleic acid synthesis (By similarity). It also influences optic nerve development by supporting SHH-dependent oligodendrocyte precursor cell migration and proliferation (By similarity). In reproductive tissues, it mediates uptake of SHBG-bound androgens and estrogens (By similarity). Additionally, it endocytoses angiotensin-2 and angiotensin 1-7 (By similarity) and promotes lysosomal degradation of CLU/APOJ-bound beta-amyloid protein 40 (By similarity). LRP2/Megalin is crucial for embryonic heart development and normal hearing, potentially through interactions with estrogen in the inner ear (By similarity).

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His;C-StrepⅡ
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LRP2 (Q1025-N1349)
      Accession # P98164
    • His-StrepⅡ
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    LRP2; LRP-2; LDL Receptor Related Protein 2; Low Density Lipoprotein Receptor-Related Protein II; Megalin; Low Density Lipoprotein Receptor-Related Protein 2; Gp330; Heymann Nephritis Antigen Homolog; Low-Density Lipoprotein Receptor-Related Protein 2; Un

  • AA Sequence

    QCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCN

  • Predicted Molecular Mass

    38.2 kDa

  • Molecular Weight

    Approximately 45-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of 10 mM HEPES, 150 mM NaCl, 5 mM CaCl2, 0.005% Tween 20, pH 7.4 and 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00