LY6G6D Protein, Rat (P. pastoris, His)
- Species: Rat
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Rat
-
Source P. pastoris
-
Tag N-6*His
-
Accession
Q6MG58 (Q20-N108)
-
Gene ID415062
-
Molecular Construction
-
N-term
-
6*His
-
LY6G6D (Q20-N108)
Accession # Q6MG58 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LY6G6D; Lymphocyte Antigen 6 Complex Locus Protein G6d; Prev. C6orf23; Protein Ly6-D; MEGT1; Lymphocyte Antigen 6 Complex Locus G6D; NG25; Chromosome 6 Open Reading Frame 23; G6D; LY6G6D Protein, Isoform B; Ly6-D; Lymphocyte Antigen-6 G6D; Megakaryocyte-E
-
AA Sequence
QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
