MAGP-2/MFAP5 Protein, Human (HEK293, hFc)
MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, hFc)is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, hFc)is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The MAGP-2/MFAP5 protein is suggested to potentially play a role in hematopoiesis, indicating its involvement in crucial processes related to blood cell formation. In the cardiovascular system, it is proposed to regulate growth factors or participate in cell signaling to maintain the integrity of large vessels. Notably, MAGP-2/MFAP5 functions as a component of the elastin-associated microfibrils, contributing to the structural organization of these extracellular matrix elements. Additionally, it interacts with key signaling molecules such as TGFB2 and BMP2, suggesting a role in modulating signaling pathways. Furthermore, MAGP-2/MFAP5 engages in interactions with FBN1 and FBN2, emphasizing its involvement in the dynamic network of proteins associated with fibrillin and contributing to the overall maintenance of tissue architecture and function. The multifaceted functions and molecular interactions of MAGP-2/MFAP5 underscore its significance in both hematopoiesis and cardiovascular homeostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q13361-1 (I22-L173)
-
Gene ID8076
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MFAP5; MAGP-2; Microfibril Associated Protein 5; MFAP-5; MAGP2; CDNA FLJ42377 Fis, Clone UTERU2035469, Highly Similar To Microfibrillar-Associated Protein 5; MP25; Microfibril-Associated Glycoprotein 2; Microfibril-Associated Glycoprotein-2; THE1A-MFAP5;
-
AA Sequence
IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
-
Predicted Molecular Mass
44.1 kDa
-
Molecular Weight
Approximately 32-38 kDa & 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
