MANSC1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
MANSC is a novel domain with a well-conserved seven-cysteine motif that is present at the N terminus of membrane and extracellular proteins. MANSC might be involved in development, regeneration of tissue injury, Alzheimer’s disease, and tumor invasion and metastasis. MANSC1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MANSC1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MANSC is a novel domain with a well-conserved seven-cysteine motif that is present at the N terminus of membrane and extracellular proteins. MANSC might be involved in development, regeneration of tissue injury, Alzheimer’s disease, and tumor invasion and metastasis[1]. MANSC1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MANSC1 protein, expressed by HEK293 , with C-His labeled tag.
MANSC (motif at N terminus with seven cysteines) is a novel domain with a well-conserved seven-cysteine motif that is present at the N terminus of membrane and extracellular proteins, including low-density lipoprotein receptor-related protein 11 (LRP-11), hepatocyte growth factor activator inhibitor 1 (HAI-1) and some uncharacterized proteins encoded by multicellular animals from Mollusca to Chordata[1].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9CR33 (G25-L369)
-
Molecular Construction
-
N-term
-
MANSC1 (G25-L369)
Accession # Q9CR33 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MANSC1; MANSC Domain-Containing Protein 1; MANSC Domain Containing 1; FLJ10298; LOH12CR3; 9130403P13Rik; Loss Of Heterozygosity 12 Chromosomal Region 3 Protein
-
AA Sequence
GQNCLTKSLEDVVIDIQSSLSKGIRGNEPIHLATQEDCIGACCSTKDIAGDKACNLMIFDTRKTDRQPNCYLFFCPSEDACPLKPAKGLVTYRLIRDFPLTSANSSLQQLTQGEFLLLDHSSPGATPGFRTPAGYPKPTGLSWSDRSSLKSTAPLHLRKHIKADETSMQLPEEKSHSQSLQLPSELKMAHLLPKTVPTPPTTVAVAPLRNVSATLKPELLLTSISVTAKTLKQKEATTASPVTTVTSKLPGVPGSTSFTPVVTHQAALTNTFQAHTDSKGILETMPFQGGSTLTSDPRHGKSSTSESSITNKTASWEDRRVSVGSASLNKGPKSQHGLSFEKWLL
-
Predicted Molecular Mass
38.2 kDa
-
Molecular Weight
Approximately 58-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
