MAP2K6 Protein, Human (sf9, His)

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MAP2K6 Protein, Human (sf9, His) is the recombinant human-derived MAP2K6 protein, expressed by sf9 insect cells , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MAP2K6 Protein, Human (sf9, His) is the recombinant human-derived MAP2K6 protein, expressed by sf9 insect cells , with N-6*His labeled tag.

Background

MKK6, a dual specificity protein kinase, serves as an integral component of the MAP kinase signal transduction pathway. In collaboration with MAP3K3/MKK3, MKK6 catalyzes the simultaneous phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13, and MAPK14, playing a pivotal role in regulating cellular responses to cytokines and various stress stimuli. Both MKK3 and MKK6 are essential for activating MAPK11 and MAPK13 in response to environmental stress, with MKK6 emerging as the principal activator of MAPK11 upon TNF stimulation. Additionally, MKK6 phosphorylates and activates PAK6. The downstream effects of the p38 MAP kinase signal transduction pathway include the direct activation of transcription factors such as ATF2 and ELK1. Within this pathway, MKK6 mediates the phosphorylation of STAT4 through MAPK14 activation, leading to the activation of STAT4 and its regulation of gene expression in response to IL-12 stimulation. Furthermore, the pathway is crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction, as well as IFNG-dependent gene transcription. MKK6 plays a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, contributes to endochondral ossification, and likely influences SOX9 as a downstream target of the p38 MAPK pathway. Moreover, MKK6 is involved in mediating apoptotic cell death in thymocytes and serves as a regulator for melanocyte dendricity by modulating Rho family GTPases.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • MAP2K6 (M1-D334)
      Accession # P52564-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MAP2K6; Stress-Activated Protein Kinase Kinase 3; Prev. PRKMK6; SAPK Kinase 3; SAPKK3; SAPKK-3; MEK6; MAPKK 6; MKK6; CRCMSL; MAPKK6; MEK 6; Protein Kinase, Mitogen-Activated, Kinase 6 (MAP Kinase Kinase 6); Mitogen-Activated Protein Kinase Kinase; Dual Sp

  • AA Sequence

    MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

  • Predicted Molecular Mass

    39.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00