MAP3K1 Protein, Mouse (His)
MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways.Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4.MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways.Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4.MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E.coli , with N-6*His labeled tag.
Background
MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) is a critical component of a protein kinase signal transduction cascade, playing a key role in cellular signaling. It functions by activating the ERK and JNK kinase pathways through the phosphorylation of MAP2K1 and MAP2K4. Additionally, MAP3K1 may phosphorylate the MAPK8/JNK1 kinase, further contributing to the regulation of cellular responses. Moreover, MAP3K1 has the ability to activate CHUK and IKBKB, central protein kinases in the NF-kappa-B pathway, suggesting its involvement in the modulation of immune and inflammatory responses. The multifaceted actions of MAP3K1 highlight its importance in orchestrating complex signaling networks, making it a crucial regulator of various cellular processes. (
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P53349 (Q1216-W1493)
-
Molecular Construction
-
N-term
-
6*His
-
MAP3K1 (Q1216-W1493)
Accession # P53349 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MAP3K1; MEK Kinase 1; Prev. MEKK1; Mitogen-Activated Protein Kinase Kinase Kinase 1, E3 Ubiquitin Protein Ligase; MAPKKK1; Alternative Protein MAP3K1; MEKK; MAP/ERK Kinase Kinase 1; MAPK/ERK Kinase Kinase 1; SRXY6; Mitogen-Activated Protein Kinase Kinase
-
AA Sequence
QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW
-
Predicted Molecular Mass
34.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
