MASP1 Protein, Human (Active, 272a.a, HEK293, His)
Based on 1 Customer Validation
MASP1 Protein, Human (Active, 272a.a, HEK293, His) is the recombinant human-derived MASP1 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MASP1 Protein, Human (Active, 272a.a, HEK293, His) is the recombinant human-derived MASP1 protein, expressed by HEK293, with C-His tag.
Background
MASP1 functions in the lectin pathway of complement, which plays a key role in innate immunity by recognizing pathogens through sugar moiety patterns and neutralizing them. The lectin pathway is triggered when mannan-binding lectin (MBL) and ficolins bind to sugar moieties, leading to activation of the associated proteases MASP1 and MASP2. It acts as an endopeptidase and may activate MASP2 or C2, or directly activate C3, the central component of the complement cascade. Isoform 2 may inhibit lectin pathway activation or cleave IGFBP5. MASP1 also contributes to developmental processes.
Verified Bioactivity
1.Measured by its ability to cleave a colorimetric peptide substrate, N-carbobenzyloxy-Lys-ThioBenzyl ester (Z-Lys-SBzl), in the presence of 5,5’Dithio-bis (2-nitrobenzoic acid) (DTNB). The specific activity is >7500 pmol/min/µg, as measured under the described conditions.
2.Immobilized Human MASP3, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-MASP3 Antibody, hFc Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P48740-2 (I450-V721)
-
Gene ID5648
-
Molecular Construction
-
N-term
-
MASP1 (I450-V721)
Accession # P48740-2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MASP1; Mannan-Binding Lectin Serine Protease 1; Prev. CRARF; Serine Protease 5; Prev. PRSS5; CRARF1; Mannose-Binding Lectin-Associated Serine Protease 1; RaRF; MASP-3; Mannan-Binding Lectin Serine Peptidase 1 (C4/C2 Activating Component Of Ra-Reactive Fac
-
AA Sequence
IIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSV
-
Predicted Molecular Mass
31.6 kDa
-
Molecular Weight
Approximately 38-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 7.5 with 10% trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
