MASP1 Protein, Human (Active, 272a.a, HEK293, His)

MASP1 Protein, Human (Active, 272a.a, HEK293, His) is the recombinant human-derived MASP1 protein, expressed by HEK293, with C-His tag.

MASP1 functions in the lectin pathway of complement, which plays a key role in innate immunity by recognizing pathogens through sugar moiety patterns and neutralizing them. The lectin pathway is triggered when mannan-binding lectin (MBL) and ficolins bind to sugar moieties, leading to activation of the associated proteases MASP1 and MASP2. It acts as an endopeptidase and may activate MASP2 or C2, or directly activate C3, the central component of the complement cascade. Isoform 2 may inhibit lectin pathway activation or cleave IGFBP5. MASP1 also contributes to developmental processes.

Measured by its ability to cleave a colorimetric peptide substrate, N-carbobenzyloxy-Lys-ThioBenzyl ester (Z-Lys-SBzl), in the presence of 5,5’Dithio-bis (2-nitrobenzoic acid) (DTNB). The specific activity is >7500 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-His

P48740-2 (I450-V721)

5648

Partial

IIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSV

Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 7.5 with 10% trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.