Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His)
Matrix protein 1 (M1) plays a key role in viral replication, entry, uncoating, assembly, and budding.Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP facilitates nuclear export.Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E.coli , with N-His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Matrix protein 1 (M1) plays a key role in viral replication, entry, uncoating, assembly, and budding.Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP facilitates nuclear export.Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E.coli , with N-His labeled tag.
Background
Matrix protein 1 (M1) is integral to various stages of virus replication, playing essential roles from virus entry and uncoating to the assembly and budding of the virus particle. M1's binding to ribonucleocapsids (RNPs) in the nucleus is believed to inhibit viral transcription, and its interaction with viral NEP promotes the nuclear export of the complex, targeting it to the virion assembly site at the apical plasma membrane in polarized epithelial cells. Interactions with NA and HA potentially bring M1 into lipid rafts, despite it being a non-raft-associated protein. Within the virion, M1 forms a continuous shell on the inner side of the lipid bilayer, binding the RNP. During virus entry, the M2 ion channel acidifies the internal virion core, leading to M1 dissociation from the RNP. M1-free RNPs are then transported to the nucleus, allowing viral transcription and replication. Moreover, M1 determines the virion's shape, influencing whether it is spherical or filamentous. Clinical isolates of influenza often feature a significant proportion of filamentous virions, crucial for infecting neighboring cells, while spherical virions are better suited for aerosol-based spread between host organisms.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-His
-
Accession
Q8BAC3 (M1-K252)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His
-
H1N1 M1 (M1-K252)
Accession # Q8BAC3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Influenza A H1N1 (A/Brevig Mission/1/1918) Matrix protein 1 / M1 Protein (His)
-
AA Sequence
MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYSAGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLIENLQAYQKRMGVQMQRFK
-
Predicted Molecular Mass
30 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)