1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Matrix Protein 1
  5. Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His)

Matrix protein 1 (M1) plays a key role in viral replication, entry, uncoating, assembly, and budding.Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP facilitates nuclear export.Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E.coli , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Matrix protein 1 (M1) plays a key role in viral replication, entry, uncoating, assembly, and budding.Binding to ribonucleocapsids inhibits viral transcription, and interaction with NEP facilitates nuclear export.Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His) is the recombinant Virus-derived Matrix protein 1/M1 protein, expressed by E.coli , with N-His labeled tag.

Background

Matrix protein 1 (M1) is integral to various stages of virus replication, playing essential roles from virus entry and uncoating to the assembly and budding of the virus particle. M1's binding to ribonucleocapsids (RNPs) in the nucleus is believed to inhibit viral transcription, and its interaction with viral NEP promotes the nuclear export of the complex, targeting it to the virion assembly site at the apical plasma membrane in polarized epithelial cells. Interactions with NA and HA potentially bring M1 into lipid rafts, despite it being a non-raft-associated protein. Within the virion, M1 forms a continuous shell on the inner side of the lipid bilayer, binding the RNP. During virus entry, the M2 ion channel acidifies the internal virion core, leading to M1 dissociation from the RNP. M1-free RNPs are then transported to the nucleus, allowing viral transcription and replication. Moreover, M1 determines the virion's shape, influencing whether it is spherical or filamentous. Clinical isolates of influenza often feature a significant proportion of filamentous virions, crucial for infecting neighboring cells, while spherical virions are better suited for aerosol-based spread between host organisms.

Species

Virus

Source

E. coli

Tag

N-His

Accession

Q8BAC3 (M1-K252)

Gene ID

/

Molecular Construction
N-term
His
H1N1 M1 (M1-K252)
Accession # Q8BAC3
C-term
Protein Length

Full Length

Synonyms
Influenza A H1N1 (A/Brevig Mission/1/1918) Matrix protein 1 / M1 Protein (His)
AA Sequence

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYSAGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLIENLQAYQKRMGVQMQRFK

Predicted Molecular Mass
30 kDa
Peso molecular

Approximately 35 kDa,based on SDS-PAGE under reducing conditions.

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Matrix protein 1/M1 Protein, H1N1 (Q8BAC3, His)
Cat. No.:
HY-P74761
Cantidad:
MCE Japan Authorized Agent: