MCEMP1 Protein, Mouse (HEK293, Fc)
MCEMP1, a type II transmembrane protein, is a lung-specific surface protein and functions as an adaptor for KIT, which promotes SCF-mediated mast cell proliferation. MCEMP1 elicits intracellular signaling through its cytoplasmic immunoreceptor tyrosine-based activation motif and forms a complex with KIT to enhance its autophosphorylation and activation. MCEMP1 regulates cell chemotaxis, adhesion, and migration in a TGFβ dependent manner. MCEMP1 acts as a critical factor in allergic and inflammatory lung diseases. MCEMP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MCEMP1 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MCEMP1, a type II transmembrane protein, is a lung-specific surface protein and functions as an adaptor for KIT, which promotes SCF-mediated mast cell proliferation. MCEMP1 elicits intracellular signaling through its cytoplasmic immunoreceptor tyrosine-based activation motif and forms a complex with KIT to enhance its autophosphorylation and activation. MCEMP1 regulates cell chemotaxis, adhesion, and migration in a TGFβ dependent manner. MCEMP1 acts as a critical factor in allergic and inflammatory lung diseases[1][2]. MCEMP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MCEMP1 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
MCEMP1 deficiency impairs SCF-induced peritoneal mast cell proliferation in vitro and lung mast cell expansion in vivo. Mcemp1-deficient mice exhibit reduced airway inflammation and lung impairment in chronic asthma mouse models. the deletion of JM and KD1 regions of KIT led to a loss of binding to MCEMP1, suggesting that MCEMP1 may interact with either the JM or KD1 domain of KIT and interfere with its autoinhibitory configuration and keeps the kinase domain of KIT in an active form. Human MCEMP1 shares 44% amino acid sequence identity with mouse MCEMP1 ortholog. MCEMP1 is a crucial factor that mediates immune responses and airway inflammation in the development of chronic asthma[1][2].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q9D8U6 (K92-T183)
-
Molecular Construction
-
N-term
-
hFc
-
MCEMP1 (K92-T183)
Accession # Q9D8U6 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MCEMP1; Mast Cell-Expressed Membrane Protein 1; Prev. C19orf59; Mast Cell-Expressed Membrane Protein 1, Isoform CRA_a; Epididymis Secretory Sperm Binding Protein; Chromosome 19 Open Reading Frame 59; Mast Cell Expressed Membrane Protein 1; MGC132456
-
AA Sequence
KNSEMSKELWTLKAELSNVSDTVWNIRELQNQQTRIWEAAQGDIKEVKKTLGTVMSSIQTGNDRLKTVPADITQIKKTLEALEKKAQPQPST
-
Predicted Molecular Mass
37.7 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
