MCEMP1 Protein, Mouse (HEK293, Fc)

MCEMP1, a type II transmembrane protein, is a lung-specific surface protein and functions as an adaptor for KIT, which promotes SCF-mediated mast cell proliferation. MCEMP1 elicits intracellular signaling through its cytoplasmic immunoreceptor tyrosine-based activation motif and forms a complex with KIT to enhance its autophosphorylation and activation. MCEMP1 regulates cell chemotaxis, adhesion, and migration in a TGFβ dependent manner. MCEMP1 acts as a critical factor in allergic and inflammatory lung diseases^[1][2]. MCEMP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MCEMP1 protein, expressed by HEK293 , with N-hFc labeled tag.

MCEMP1 deficiency impairs SCF-induced peritoneal mast cell proliferation in vitro and lung mast cell expansion in vivo. Mcemp1-deficient mice exhibit reduced airway inflammation and lung impairment in chronic asthma mouse models. the deletion of JM and KD1 regions of KIT led to a loss of binding to MCEMP1, suggesting that MCEMP1 may interact with either the JM or KD1 domain of KIT and interfere with its autoinhibitory configuration and keeps the kinase domain of KIT in an active form. Human MCEMP1 shares 44% amino acid sequence identity with mouse MCEMP1 ortholog. MCEMP1 is a crucial factor that mediates immune responses and airway inflammation in the development of chronic asthma^[1][2].

Mouse

HEK293

N-hFc

Q9D8U6 (K92-T183)

69189  [NCBI]

Extracellular Domain

KNSEMSKELWTLKAELSNVSDTVWNIRELQNQQTRIWEAAQGDIKEVKKTLGTVMSSIQTGNDRLKTVPADITQIKKTLEALEKKAQPQPST

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.