MDC/CCL22 Protein, Mouse (N-His)

Customer Review

Based on 1 Customer Validation

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Verified Bioactivity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR4. The ED50 for this effect is 2.471 ng/mL, corresponding to a specific activity is 4.047×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR4. The ED50 for this effect is 2.471 ng/mL, corresponding to a specific activity is 4.047×105 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • MDC (G25-S92)
      Accession # O88430
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL22; Macrophage-Derived Chemokine; Prev. SCYA22; CC Chemokine STCP-1; MDC; MDC(1-69); A-152E5.1; MGC34554; DC/B-CK; Stimulated T Cell Chemotactic Protein 1; STCP-1; Stimulated T-Cell Chemotactic Protein 1; ABCD-1; Small Inducible Cytokine A22; Small Ind

  • AA Sequence

    GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

  • Predicted Molecular Mass

    9.2 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 50% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00