MDC/CCL22 Protein, Mouse (N-His)
Based on 1 Customer Validation
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Verified Bioactivity
Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR4. The ED50 for this effect is 2.471 ng/mL, corresponding to a specific activity is 4.047×105 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His
-
Accession
O88430 (G25-S92)
-
Gene ID20299
-
Molecular Construction
-
N-term
-
10*His
-
MDC (G25-S92)
Accession # O88430 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL22; Macrophage-Derived Chemokine; Prev. SCYA22; CC Chemokine STCP-1; MDC; MDC(1-69); A-152E5.1; MGC34554; DC/B-CK; Stimulated T Cell Chemotactic Protein 1; STCP-1; Stimulated T-Cell Chemotactic Protein 1; ABCD-1; Small Inducible Cytokine A22; Small Ind
-
AA Sequence
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
-
Predicted Molecular Mass
9.2 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 50% Acetonitrile, pH 2.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping with dry ice.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)