MDC/CCL22 Protein, Mouse (N-His)

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR4. The ED₅₀ for this effect is 2.471 ng/mL, corresponding to a specific activity is 4.047×10⁵ U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR4. The ED₅₀ for this effect is 2.471 ng/mL, corresponding to a specific activity is 4.047×10⁵ U/mg.

Mouse

E. coli

N-10*His

O88430 (G25-S92)

20299

Full Length of Mature Protein

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 50% Acetonitrile, pH 2.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping with dry ice.