Melanotransferrin/CD228 Protein, Mouse (HEK293, Fc)
Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Melanotransferrin/CD228 protein is implicated in cellular iron uptake, where it appears to undergo internalization and subsequent recycling back to the cell membrane. Each subunit of this protein has the capacity to bind a single atom of iron, suggesting its role in intracellular iron transport. Additionally, Melanotransferrin/CD228 could potentially bind zinc, indicating a versatility in metal ion binding capabilities.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9R0R1 (V20-Q708)
-
Molecular Construction
-
N-term
-
Melanotransferrin (V20-Q708)
Accession # Q9R0R1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Melanotransferrin Chain
-
Synonyms
MELTF; Antigen P97 (Melanoma Associated) Identified By Monoclonal Antibodies 133.2 And 96.5; Prev. MFI2; FLJ38863; MAP97; MGC4856; CD228; Melanoma-Associated Antigen P97; MTF1; CD228 Antigen; MTf; Melanotransferrin; Membrane-Bound Transferrin-Like Protein
-
AA Sequence
VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ
-
Predicted Molecular Mass
103 kDa
-
Molecular Weight
Approximately 100 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
