Copy Link Print Information

Melanotransferrin/CD228 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Melanotransferrin/CD228 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Melanotransferrin/CD228 Protein, Mouse (HEK293, His)
  • Melanotransferrin/CD228 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-His labeled tag.

Background

Melanotransferrin/CD228 protein is implicated in cellular iron uptake, where it appears to undergo internalization and subsequent recycling back to the cell membrane. Each subunit of this protein has the capacity to bind a single atom of iron, suggesting its role in intracellular iron transport. Additionally, Melanotransferrin/CD228 could potentially bind zinc, indicating a versatility in metal ion binding capabilities.

Verified Bioactivity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q9R0R1 (V20-Q708)

  • Gene ID
    30060  [NCBI]
  • Molecular Construction
    • N-term
    • Melanotransferrin (V20-Q708)
      Accession # Q9R0R1
    • His
    • C-term
  • Protein Length

    Full Length of Melanotransferrin Chain

  • Synonyms

    MELTF; Antigen P97 (Melanoma Associated) Identified By Monoclonal Antibodies 133.2 And 96.5; Prev. MFI2; FLJ38863; MAP97; MGC4856; CD228; Melanoma-Associated Antigen P97; MTF1; CD228 Antigen; MTf; Melanotransferrin; Membrane-Bound Transferrin-Like Protein

  • AA Sequence

    VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ

  • Molecular Weight

    Approximately 80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg.

  • Melanotransferrin/CD228 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Melanotransferrin/CD228 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Melanotransferrin/CD228 Protein, Mouse (HEK293, His)
  • Melanotransferrin/CD228 Protein, Mouse (HEK293, His) Product Image