MERS-CoV Spike/S Protein RBD (sf9, His)
The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. The engagement of the MERS-CoV spike protein S1 with CD26 (also known as dipeptidyl peptidase 4, DPP4) mediates viral attachment to host cells and virus鈥揷ell fusion, thereby initiating infection. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein and S2' is unmasked following S2 cleavage occurring upon virus endocytosis. MERS-CoV Spike/S Protein RBD (sf9, His) is the recombinant Virus-derived MERS-CoV Spike/S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. The engagement of the MERS-CoV spike protein S1 with CD26 (also known as dipeptidyl peptidase 4, DPP4) mediates viral attachment to host cells and virus鈥揷ell fusion, thereby initiating infection. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein and S2' is unmasked following S2 cleavage occurring upon virus endocytosis. MERS-CoV Spike/S Protein RBD (sf9, His) is the recombinant Virus-derived MERS-CoV Spike/S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The MERS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S1 can attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. S2' acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Under the current model, S protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
The engagement of the MERS-CoV spike protein S1 with CD26 (also known as dipeptidyl peptidase 4, DPP4) mediates viral attachment to host cells and virus–cell fusion, thereby initiating infection[1].
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
K0BRG7/AFS88936.1 (E367-Y606)
-
Gene ID14254594 [NCBI]
-
Molecular Construction
-
N-term
-
MERS-CoV Spike RBD (E367-Y606)
Accession # K0BRG7/AFS88936.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Spike glycoprotein; S glycoprotein; E2; Peplomer protein; S
-
AA Sequence
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
-
Predicted Molecular Mass
27.7 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)