Mesothelin Protein, Mouse (HEK293, Fc)
Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293, with C-hFc labeled tag.
Background
Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating interactions between cells. Additionally, Megakaryocyte-potentiating factor (MPF) has been associated with the enhancement of megakaryocyte colony formation, indicating its involvement in processes related to the development of these specialized blood cell colonies.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q61468 (D298-S600)
-
Gene ID56047
-
Molecular Construction
-
N-term
-
Mesothelin (D298-S600)
Accession # Q61468 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mesothelin, cleaved form
-
Synonyms
MSLN; CAK1; Mesothelin; Soluble MPF Mesothelin Related Protein; MPF; Megakaryocyte Potentiating Factor; Pre-Pro-Megakaryocyte-Potentiating Factor; SMRP; CAK1 Antigen
-
AA Sequence
DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
-
Predicted Molecular Mass
60.6 kDa
-
Molecular Weight
Approximately 67-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)