Meteorin Protein, Mouse (HEK293, Fc)

Meteorin, a multifunctional protein, is pivotal in neurogenesis, influencing glial cell differentiation and axonal network formation. It promotes astrocyte differentiation, transforms cerebellar astrocytes into radial glia, and induces axonal extension in sensory ganglia neurons. As a monomeric entity, Meteorin orchestrates glial cell differentiation and axonal network formation, emphasizing its crucial role in neurogenesis. Meteorin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Meteorin protein, expressed by HEK293 , with N-hFc labeled tag.

Meteorin, a multifaceted protein, plays a pivotal role in neurogenesis by contributing to both glial cell differentiation and the formation of axonal networks. Its influence extends to promoting astrocyte differentiation and orchestrating the transformation of cerebellar astrocytes into radial glia. Additionally, Meteorin exerts its effects on sensory ganglia, inducing axonal extension in small and intermediate neurons by activating neighboring satellite glia. As a monomeric entity, Meteorin acts as a key orchestrator in the intricate processes of glial cell differentiation and axonal network formation during neurogenesis.

Mouse

HEK293

N-hFc

Q8C1Q4-1 (G22-D291)

70083  [NCBI]

Full Length of Isoform-1 Mature Protein

GYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALD

Approximately 57-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.