metK Protein, Shigella sonnei (His)

The metK protein plays a crucial role in cellular processes by catalyzing the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. This enzymatic activity involves a two-step process, first synthesizing AdoMet and then hydrolyzing tripolyphosphate. metK Protein, Shigella sonnei (His) is the recombinant metK protein, expressed by E. coli , with N-6*His labeled tag.

MetK, or methionine adenosyltransferase, plays a crucial role in cellular metabolism by catalyzing the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. This enzymatic reaction involves two sequential steps: the initial synthesis of AdoMet and the subsequent hydrolysis of tripolyphosphate, occurring before the release of AdoMet from the enzyme. S-adenosylmethionine serves as a primary methyl donor in various biochemical reactions, participating in processes such as DNA methylation, protein methylation, and the biosynthesis of polyamines and certain secondary metabolites. MetK's activity is pivotal for maintaining cellular methylation potential and ensuring the availability of AdoMet, a key cofactor involved in numerous essential metabolic pathways. It has to succinctly outline MetK's role in the synthesis of S-adenosylmethionine, emphasizing its significance in cellular methylation processes and broader metabolic regulation.

Others

E. coli

N-6*His

Q3YXS9 (M1-K384)

75205223

Full Length

MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK

Approximately 44 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.