Copy Link Print Information

metK Protein, Shigella sonnei (His)

Customer Review

Based on 1 Customer Validation

The metK protein plays a crucial role in cellular processes by catalyzing the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. This enzymatic activity involves a two-step process, first synthesizing AdoMet and then hydrolyzing tripolyphosphate. metK Protein, Shigella sonnei (His) is the recombinant metK protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • metK Protein, Shigella sonnei (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The metK protein plays a crucial role in cellular processes by catalyzing the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. This enzymatic activity involves a two-step process, first synthesizing AdoMet and then hydrolyzing tripolyphosphate. metK Protein, Shigella sonnei (His) is the recombinant metK protein, expressed by E. coli , with N-6*His labeled tag.

Background

MetK, or methionine adenosyltransferase, plays a crucial role in cellular metabolism by catalyzing the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. This enzymatic reaction involves two sequential steps: the initial synthesis of AdoMet and the subsequent hydrolysis of tripolyphosphate, occurring before the release of AdoMet from the enzyme. S-adenosylmethionine serves as a primary methyl donor in various biochemical reactions, participating in processes such as DNA methylation, protein methylation, and the biosynthesis of polyamines and certain secondary metabolites. MetK's activity is pivotal for maintaining cellular methylation potential and ensuring the availability of AdoMet, a key cofactor involved in numerous essential metabolic pathways. It has to succinctly outline MetK's role in the synthesis of S-adenosylmethionine, emphasizing its significance in cellular methylation processes and broader metabolic regulation.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q3YXS9 (M1-K384)

  • Gene ID
    75205223
  • Molecular Construction
    • N-term
    • 6*His
    • metK (M1-K384)
      Accession # Q3YXS9
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S-adenosylmethionine synthase; EC:2.5.1.6; AdoMet synthase; MAT; Methionine adenosyltransferase; metK; SSON_3096

  • AA Sequence

    MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • metK Protein, Shigella sonnei (His) Product Image
    1/16
  • metK Protein, Shigella sonnei (His) Product Image