MGLL Protein, Human (His)
Based on 1 Customer Validation
MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human (His) is the recombinant human-derived MGLL protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human (His) is the recombinant human-derived MGLL protein, expressed by E. coli , with N-6*His labeled tag.
MGLL, a pivotal enzyme in lipid metabolism, serves as a key catalyst in the conversion of monoacylglycerides into free fatty acids and glycerol, as evidenced by its documented roles in various studies. Beyond its involvement in lipid metabolism, MGLL exhibits the ability to hydrolyze the endocannabinoid 2-arachidonoylglycerol, thereby contributing significantly to the intricate regulation of endocannabinoid signaling and influencing nociperception and the perception of pain. Notably, MGLL plays a crucial role in regulating the levels of fatty acids, which act as essential signaling molecules with implications for diverse cellular functions. This enzyme's impact extends to cancer biology, where it is implicated in the promotion of cancer cell migration, invasion, and overall tumor growth, as indicated by various studies.
Measured by its ability to hydrolyze 4-Nitrophenyl butyrate. The specific activity is 26422.715 pmol/min/µg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q99685 (P2-P303)
-
Gene ID11343
-
Molecular Construction
-
N-term
-
6*His
-
MGLL (P2-P303)
Accession # Q99685 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MGLL; MGL; Monoglyceride Lipase; Lysophospholipase Homolog; Monoacylglycerol Lipase; Lysophospholipase-Like; HU-K5; HUK5; MAGL
-
AA Sequence
PEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
-
Predicted Molecular Mass
35.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol.
2.Supplied as a 0.22 μm filtered solution of PBS.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
