1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. MGLL Protein, Human (His)

MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human (His) is the recombinant human-derived MGLL protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human (His) is the recombinant human-derived MGLL protein, expressed by E. coli , with N-6*His labeled tag.

Background

MGLL, a pivotal enzyme in lipid metabolism, serves as a key catalyst in the conversion of monoacylglycerides into free fatty acids and glycerol, as evidenced by its documented roles in various studies. Beyond its involvement in lipid metabolism, MGLL exhibits the ability to hydrolyze the endocannabinoid 2-arachidonoylglycerol, thereby contributing significantly to the intricate regulation of endocannabinoid signaling and influencing nociperception and the perception of pain. Notably, MGLL plays a crucial role in regulating the levels of fatty acids, which act as essential signaling molecules with implications for diverse cellular functions. This enzyme's impact extends to cancer biology, where it is implicated in the promotion of cancer cell migration, invasion, and overall tumor growth, as indicated by various studies.

Biological Activity

Measured by its ability to hydrolyze 4-Nitrophenyl butyrate. The specific activity is 26422.715 pmol/min/µg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q99685 (P2-P303)

Gene ID

11343

Molecular Construction
N-term
6*His
MGLL (P2-P303)
Accession # Q99685
C-term
Protein Length

Partial

Synonyms
MGLL; Monoglyceride lipase; MGL; HU-K5; Lysophospholipase homolog; Lysophospholipase-like; Monoacylglycerol lipase; MAGL
AA Sequence

PEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP

Molecular Weight

Approximately 35.2 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol.
2.Supplied as a 0.22 μm filtered solution of PBS.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MGLL Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MGLL Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MGLL Protein, Human (His)
Cat. No.:
HY-P701985
Quantity:
MCE Japan Authorized Agent: