1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. MIP-2/CXCL2 Protein, Mouse (HEK293)

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. MIP-2/CXCL2 Protein, Mouse is produced in HEK293.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
Échantillon gratuit   Apply now
5 μg En stock
10 μg En stock
25 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. MIP-2/CXCL2 Protein, Mouse is produced in HEK293.

Background

CXCL2 is a chemokine induced by endotoxin and serves as an extremely potent chemo-attractant for neutrophils, acting as a crucial inflammatory mediator. CXCL2 could be produced by multiple, different cell types, including macrophages and cancer cells. CXCL2 is involved in cancer metastasis, angiogenesis, and wound healing[1][4][5].
The amino acid sequence of human CXCL2 protein has low homology between mouse and rat CXCL2 protein.
CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 binds to the G-protein coupled receptor CXCR2 (IL-8RB) expressed on macrophages, neutrophils, and epithelial cells and its classical function is to act as chemotactic factors attracting neutrophils to sites of injury[2][3].
In enterocytes, LPS induces CXCL2 expression and promotes migration of neutrophils in a model of platelet-activating factor induced shock and bowel injury. In acute lung injury, CXCR2 ligands, including CXCL1/2/3, have chemotactic effects for polymorphonuclear leukocytes[4]. CXCL2 could provoke a dose-dependent increase of colorectal tumor cell migration in vitro. Further, according to Bachmeier et al., CXCL-1 and −2 silencing could down-regulate several metastasis-promoting genes and inhibit the metastatic potential of breast cancer cells[5].

Species

Mouse

Source

HEK293

Accession

P10889 (A28-N100)

Gene ID

20310

Molecular Construction
N-term
CXCL2 (A28-N100)
Accession # P10889
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuMIP-2/CXCL2; C-X-C motif chemokine 2; SCYB2
AA Sequence

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Predicted Molecular Mass
8 kDa
Masse moléculaire

Approximately 7.8 kDa,based on SDS-PAGE under reducing conditions.

Pureté

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation

MIP-2/CXCL2 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

MIP-2/CXCL2 Protein, Mouse (HEK293)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
MIP-2/CXCL2 Protein, Mouse (HEK293)
Cat. No.:
HY-P7258A
Quantité:
MCE Japan Authorized Agent: