MMP-7 Protein, Human (HEK293, His)
Based on 1 Customer Validation
MMP-7 proteins enzymatically degrade a variety of substrates, including casein, gelatin (types I, III, IV, and V), and fibronectin. Its proteolytic effect activates procollagenase, indicating its role in the regulation of collagen metabolism. MMP-7 Protein, Human (HEK293, His) is the recombinant human-derived MMP-7 protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MMP-7 proteins enzymatically degrade a variety of substrates, including casein, gelatin (types I, III, IV, and V), and fibronectin. Its proteolytic effect activates procollagenase, indicating its role in the regulation of collagen metabolism. MMP-7 Protein, Human (HEK293, His) is the recombinant human-derived MMP-7 protein, expressed by HEK293, with N-His labeled tag.
Background
The Animal-Free MMP-7 protein exhibits enzymatic activity in the degradation of various substrates, including casein, gelatins of types I, III, IV, and V, and fibronectin. Its proteolytic action extends to the activation of procollagenase, indicating a role in the regulation of collagen metabolism. The diverse substrate specificity of Animal-Free MMP-7 underscores its significance in modulating the extracellular matrix and influencing cellular processes associated with tissue remodeling and turnover. This enzyme's capacity to cleave different substrates highlights its role in various physiological and pathological processes, contributing to tissue homeostasis and the dynamic regulation of the extracellular environment.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >600 pmol/min/μg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
P09237 (L18-K267)
-
Gene ID4316
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
MMP7; Pump-1 Protease; Prev. MPSL1; MMP-7; Matrilysin; Matrix Metallopeptidase 7 (Matrilysin, Uterine); PUMP-1; Matrix Metalloproteinase 7; Matrix Metalloproteinase 7 (Matrilysin, Uterine); Uterine Matrilysin; Matrix Metalloproteinase-7; PUMP1; Uterine Me
-
AA Sequence
LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
-
Predicted Molecular Mass
30 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 10 mM HEPES, 150 mM NaCl, pH7.5, 50% glycerol.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
