1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-7
  5. MMP-7 Protein, Human (HEK293, His)

MMP-7 proteins enzymatically degrade a variety of substrates, including casein, gelatin (types I, III, IV, and V), and fibronectin. Its proteolytic effect activates procollagenase, indicating its role in the regulation of collagen metabolism. MMP-7 Protein, Human (HEK293, His) is the recombinant human-derived MMP-7 protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-7 proteins enzymatically degrade a variety of substrates, including casein, gelatin (types I, III, IV, and V), and fibronectin. Its proteolytic effect activates procollagenase, indicating its role in the regulation of collagen metabolism. MMP-7 Protein, Human (HEK293, His) is the recombinant human-derived MMP-7 protein, expressed by HEK293, with N-His labeled tag.

Background

The Animal-Free MMP-7 protein exhibits enzymatic activity in the degradation of various substrates, including casein, gelatins of types I, III, IV, and V, and fibronectin. Its proteolytic action extends to the activation of procollagenase, indicating a role in the regulation of collagen metabolism. The diverse substrate specificity of Animal-Free MMP-7 underscores its significance in modulating the extracellular matrix and influencing cellular processes associated with tissue remodeling and turnover. This enzyme's capacity to cleave different substrates highlights its role in various physiological and pathological processes, contributing to tissue homeostasis and the dynamic regulation of the extracellular environment.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >600 pmol/min/μg.

Species

Human

Source

HEK293

Tag

N-His

Accession

P09237 (L18-K267)

Gene ID

4316

Protein Length

Full Length of Mature Protein

Synonyms
Matrilysin; Matrin; Matrix metalloproteinase-7; Pump-1 protease; MPSL1; PUMP1
AA Sequence

LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

Molecular Weight

Approximately 30 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 10 mM HEPES, 150 mM NaCl, pH7.5, 50% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MMP-7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MMP-7 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-7 Protein, Human (HEK293, His)
Cat. No.:
HY-P703938
Quantity:
MCE Japan Authorized Agent: