MPND Protein, Human
MPND protein is a possible protease that acts as a sensor for N(6)-methyladenosine methylation on DNA (m6A). It recognizes and binds m6A DNA, causing target DNA degradation. MPND Protein, Human is the recombinant human-derived MPND protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
MPND protein is a possible protease that acts as a sensor for N(6)-methyladenosine methylation on DNA (m6A). It recognizes and binds m6A DNA, causing target DNA degradation. MPND Protein, Human is the recombinant human-derived MPND protein, expressed by E. coli , with tag free.
Background
The MPND protein is identified as a probable protease, and in addition, it functions as a sensor for N(6)-methyladenosine methylation on DNA (m6A). This role involves the recognition and binding of m6A DNA, subsequently leading to the degradation of the targeted DNA molecules. The ability of MPND to specifically interact with and respond to N(6)-methyladenosine methylation highlights its significance in the cellular machinery involved in DNA modification and degradation processes. Further exploration of the mechanisms underlying the protease activity and m6A sensing capabilities of MPND will provide valuable insights into its regulatory functions within the context of DNA modifications and cellular homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8N594 (M1-S471)
-
Gene ID84954
-
Molecular Construction
-
N-term
-
MPND (M1-S471)
Accession # Q8N594 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MPND; MPN Domain-Containing Protein; MPN Domain Containing; FLJ14981
-
AA Sequence
MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)