1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. MPND Protein, Human

MPND protein is a possible protease that acts as a sensor for N(6)-methyladenosine methylation on DNA (m6A). It recognizes and binds m6A DNA, causing target DNA degradation. MPND Protein, Human is the recombinant human-derived MPND protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MPND protein is a possible protease that acts as a sensor for N(6)-methyladenosine methylation on DNA (m6A). It recognizes and binds m6A DNA, causing target DNA degradation. MPND Protein, Human is the recombinant human-derived MPND protein, expressed by E. coli , with tag free.

Background

The MPND protein is identified as a probable protease, and in addition, it functions as a sensor for N(6)-methyladenosine methylation on DNA (m6A). This role involves the recognition and binding of m6A DNA, subsequently leading to the degradation of the targeted DNA molecules. The ability of MPND to specifically interact with and respond to N(6)-methyladenosine methylation highlights its significance in the cellular machinery involved in DNA modification and degradation processes. Further exploration of the mechanisms underlying the protease activity and m6A sensing capabilities of MPND will provide valuable insights into its regulatory functions within the context of DNA modifications and cellular homeostasis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8N594 (M1-S471)

Gene ID

84954

Molecular Construction
N-term
MPND (M1-S471)
Accession # Q8N594
C-term
Protein Length

Full Length

Synonyms
MPND; MPN domain-containing protein
AA Sequence

MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MPND Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MPND Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MPND Protein, Human
Cat. No.:
HY-P701478
Quantity:
MCE Japan Authorized Agent: