MRPL44 Protein, Human (sf9, His)
MRPL44 protein is an important component of the 39S subunit of mitochondrial ribosomes. MRPL44 Protein, Human (sf9, His) is the recombinant human-derived MRPL44 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MRPL44 protein is an important component of the 39S subunit of mitochondrial ribosomes. MRPL44 Protein, Human (sf9, His) is the recombinant human-derived MRPL44 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
MRPL44 is a vital component of the 39S subunit of the mitochondrial ribosome, where it likely plays a role in the assembly and stability of nascent mitochondrial polypeptides as they exit the ribosome. Within the mitochondrial large ribosomal subunit (mt-LSU), MRPL44 contributes to the structural integrity and function of mature mammalian 55S mitochondrial ribosomes, which consist of a small (28S) and a large (39S) subunit. The 28S small subunit harbors a 12S ribosomal RNA (12S mt-rRNA) and 30 distinct proteins, while the 39S large subunit includes a 16S rRNA (16S mt-rRNA) and a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays a crucial structural role. In total, the 39S large subunit comprises 52 diverse proteins, underscoring MRPL44's essential contribution to mitochondrial ribosome assembly and function.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q9H9J2 (M1-S332)
-
Molecular Construction
-
N-term
-
MRPL44 (M1-S332)
Accession # Q9H9J2 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
MRPL44; FLJ13990; Mitochondrial Ribosomal Protein L44; MRP-L44; 39S Ribosomal Protein L44, Mitochondrial; Mitochondrial Large Ribosomal Subunit Protein ML44; ML44; COXPD16; Large Ribosomal Subunit Protein ML44; L44MT; FLJ12701; L44mt
-
AA Sequence
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS
-
Predicted Molecular Mass
35.7 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
