1. Recombinant Proteins
  2. Receptor Proteins
  3. MRPL44 Protein, Human (sf9, His)

MRPL44 protein is an important component of the 39S subunit of mitochondrial ribosomes. MRPL44 Protein, Human (sf9, His) is the recombinant human-derived MRPL44 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MRPL44 protein is an important component of the 39S subunit of mitochondrial ribosomes. MRPL44 Protein, Human (sf9, His) is the recombinant human-derived MRPL44 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

MRPL44 is a vital component of the 39S subunit of the mitochondrial ribosome, where it likely plays a role in the assembly and stability of nascent mitochondrial polypeptides as they exit the ribosome. Within the mitochondrial large ribosomal subunit (mt-LSU), MRPL44 contributes to the structural integrity and function of mature mammalian 55S mitochondrial ribosomes, which consist of a small (28S) and a large (39S) subunit. The 28S small subunit harbors a 12S ribosomal RNA (12S mt-rRNA) and 30 distinct proteins, while the 39S large subunit includes a 16S rRNA (16S mt-rRNA) and a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays a crucial structural role. In total, the 39S large subunit comprises 52 diverse proteins, underscoring MRPL44's essential contribution to mitochondrial ribosome assembly and function.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q9H9J2 (M1-S332)

Gene ID
Molecular Construction
N-term
MRPL44 (M1-S332)
Accession # Q9H9J2
His
C-term
Protein Length

Full Length

Synonyms
39S ribosomal protein L44, mitochondrial; L44mt; MRP-L44
AA Sequence

MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS

Predicted Molecular Mass
35.7 kDa
Molecular Weight

Approximately 40 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MRPL44 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MRPL44 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MRPL44 Protein, Human (sf9, His)
Cat. No.:
HY-P77090
Quantity:
MCE Japan Authorized Agent: