MST3/STK24 Protein, Human (Active, sf9, GST)

MST3/STK24 is a serine/threonine protein kinase that induces apoptosis in response to stress and caspase activation. It mediates oxidative stress-induced cell death by regulating the phosphorylation of JNK1-JNK2 and p38 during oxidative stress. MST3/STK24 Protein, Human (sf9, GST) is the recombinant human-derived MST3/STK24, expressed by Sf9 insect cells, with GST labeled tag.

MST3/STK24 Protein, a serine/threonine-protein kinase, plays a pivotal role in apoptosis initiation in response to stress stimuli and caspase activation. Under oxidative stress conditions, it mediates cell death by modulating the phosphorylation of JNK1-JNK2 and p38 MAPKs, highlighting its involvement in stress-induced apoptotic pathways. Additionally, MST3/STK24 contributes to a caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG, as well as the DNase activity associated with ENDOG during staurosporine-induced apoptosis. The kinase activity extends to phosphorylating STK38L and stimulating its function. In collaboration with STK26, MST3/STK24 negatively regulates Golgi reorientation during polarized cell migration induced by RHO activation. Furthermore, it influences cellular migration by altering PTPN12 activity and PXN phosphorylation, inhibiting PTPN12 and potentially regulating PXN phosphorylation. Notably, MST3/STK24 may act as a key regulator in axon regeneration, particularly in the optic nerve and radial nerve, emphasizing its diverse roles in cellular processes.

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 16 nM, the conversion rate is about 35%.

Human

Sf9 insect cells

GST

Q9Y6E0-1 (M1-H443)

8428

Full Length of Isoform-1

MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH

Approximately 76 kDa, based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 0.05% Brij35, 1 mM DTT, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.