MST3/STK24 Protein, Human (Active, sf9, GST)
Based on 1 Customer Validation
MST3/STK24 is a serine/threonine protein kinase that induces apoptosis in response to stress and caspase activation. It mediates oxidative stress-induced cell death by regulating the phosphorylation of JNK1-JNK2 and p38 during oxidative stress. MST3/STK24 Protein, Human (sf9, GST) is the recombinant human-derived MST3/STK24, expressed by Sf9 insect cells, with GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
MST3/STK24 is a serine/threonine protein kinase that induces apoptosis in response to stress and caspase activation. It mediates oxidative stress-induced cell death by regulating the phosphorylation of JNK1-JNK2 and p38 during oxidative stress. MST3/STK24 Protein, Human (sf9, GST) is the recombinant human-derived MST3/STK24, expressed by Sf9 insect cells, with GST labeled tag.
Background
MST3/STK24 Protein, a serine/threonine-protein kinase, plays a pivotal role in apoptosis initiation in response to stress stimuli and caspase activation. Under oxidative stress conditions, it mediates cell death by modulating the phosphorylation of JNK1-JNK2 and p38 MAPKs, highlighting its involvement in stress-induced apoptotic pathways. Additionally, MST3/STK24 contributes to a caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG, as well as the DNase activity associated with ENDOG during staurosporine-induced apoptosis. The kinase activity extends to phosphorylating STK38L and stimulating its function. In collaboration with STK26, MST3/STK24 negatively regulates Golgi reorientation during polarized cell migration induced by RHO activation. Furthermore, it influences cellular migration by altering PTPN12 activity and PXN phosphorylation, inhibiting PTPN12 and potentially regulating PXN phosphorylation. Notably, MST3/STK24 may act as a key regulator in axon regeneration, particularly in the optic nerve and radial nerve, emphasizing its diverse roles in cellular processes.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 16 nM, the conversion rate is about 35%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q9Y6E0-1 (M1-H443)
-
Gene ID8428
-
Protein Length
Full Length of Isoform-1
-
Synonyms
STK24; STE20; Serine/Threonine Kinase 24; Sterile 20-Like Kinase 3; MST3; STE20-Like Kinase 3; STK3; Serine/Threonine Kinase 24 (Ste20, Yeast Homolog); Mammalian STE20-Like Protein Kinase 3; Serine/Threonine Kinase 24 (STE20 Homolog, Yeast); Serine/Threonine-Protein Kinase 24; Non-Specific Serine/Threonine Protein Kinase; STE20-Like Kinase MST3; Epididymis Secretory Protein Li 95; MST-3; Alternative Protein STK24; MST3B; HEL-S-95
-
AA Sequence
MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
-
Predicted Molecular Mass
75.8 KDa
-
Molecular Weight
Approximately 76 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 0.05% Brij35, 1 mM DTT, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)