MST3/STK24 Protein, Human (Active, sf9, GST)

Customer Review

Based on 1 Customer Validation

MST3/STK24 is a serine/threonine protein kinase that induces apoptosis in response to stress and caspase activation. It mediates oxidative stress-induced cell death by regulating the phosphorylation of JNK1-JNK2 and p38 during oxidative stress. MST3/STK24 Protein, Human (sf9, GST) is the recombinant human-derived MST3/STK24, expressed by Sf9 insect cells, with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MST3/STK24 is a serine/threonine protein kinase that induces apoptosis in response to stress and caspase activation. It mediates oxidative stress-induced cell death by regulating the phosphorylation of JNK1-JNK2 and p38 during oxidative stress. MST3/STK24 Protein, Human (sf9, GST) is the recombinant human-derived MST3/STK24, expressed by Sf9 insect cells, with GST labeled tag.

Background

MST3/STK24 Protein, a serine/threonine-protein kinase, plays a pivotal role in apoptosis initiation in response to stress stimuli and caspase activation. Under oxidative stress conditions, it mediates cell death by modulating the phosphorylation of JNK1-JNK2 and p38 MAPKs, highlighting its involvement in stress-induced apoptotic pathways. Additionally, MST3/STK24 contributes to a caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG, as well as the DNase activity associated with ENDOG during staurosporine-induced apoptosis. The kinase activity extends to phosphorylating STK38L and stimulating its function. In collaboration with STK26, MST3/STK24 negatively regulates Golgi reorientation during polarized cell migration induced by RHO activation. Furthermore, it influences cellular migration by altering PTPN12 activity and PXN phosphorylation, inhibiting PTPN12 and potentially regulating PXN phosphorylation. Notably, MST3/STK24 may act as a key regulator in axon regeneration, particularly in the optic nerve and radial nerve, emphasizing its diverse roles in cellular processes.

Verified Bioactivity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 16 nM, the conversion rate is about 35%.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    STK24; STE20; Serine/Threonine Kinase 24; Sterile 20-Like Kinase 3; MST3; STE20-Like Kinase 3; STK3; Serine/Threonine Kinase 24 (Ste20, Yeast Homolog); Mammalian STE20-Like Protein Kinase 3; Serine/Threonine Kinase 24 (STE20 Homolog, Yeast); Serine/Threonine-Protein Kinase 24; Non-Specific Serine/Threonine Protein Kinase; STE20-Like Kinase MST3; Epididymis Secretory Protein Li 95; MST-3; Alternative Protein STK24; MST3B; HEL-S-95

  • AA Sequence

    MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH

  • Predicted Molecular Mass

    75.8 KDa

  • Molecular Weight

    Approximately 76 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 0.05% Brij35, 1 mM DTT, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00