Mucin-2/MUC2 Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag. ,

Background

MUC2 is a mucin that coats the epithelia of the intestines and other mucus membrane-containing organs, providing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. As the major constituent of colon mucus, it forms large polymeric networks secreted by goblet cells, covering the intestinal surfaces. These networks create hydrogels that shield the underlying epithelium from pathogens and hazardous materials while enabling nutrient absorption and gas exchange. MUC2 also acts as a divalent copper chaperone, protecting intestinal cells from copper toxicity and facilitating nutritional copper uptake. It binds both Cu2+ and Cu(1+) at adjacent sites, with Cu2+ reduced to Cu(1+) by vitamin C or dietary antioxidants, allowing its release for cellular uptake. Additionally, MUC2 gels store antimicrobial molecules for innate immunity, support the microbiome, lubricate tissues, and aid in waste removal. By similarity, goblet cells produce two forms of MUC2: a 'thick' mucus in the proximal colon that encases microbiota to form fecal pellets, and a 'thin' mucus in the distal colon that adheres to and lubricates the 'thick' mucus as it moves through the descending colon.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    MUC2; SMUC; Mucin 2, Oligomeric Mucus/Gel-Forming; Intestinal Mucin 2.1; MUC-2; Intestinal Mucin-2; MLP; Intestinal Mucin 2; Mucin 2, Intestinal/Tracheal; Intestinal Mucin; Mucin-Like Protein; Mucin 2; Mucin-2

  • AA Sequence

    VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

  • Predicted Molecular Mass

    24.8 kDa

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00