Muellerian-inhibiting factor/AMH Protein, Mouse (P.pastoris, His)

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by P. pastoris , with N-His labeled tag.

The Müllerian-inhibiting factor (AMH) protein plays a pivotal role in various reproductive processes. During male fetal sexual differentiation, it contributes significantly to Muellerian duct regression. In the adult, AMH assumes a role in Leydig cell differentiation and function. Conversely, in females, AMH acts as a negative regulator, impeding the primordial to primary follicle transition and reducing the FSH sensitivity of growing follicles. AMH exerts its effects by binding to its sole type II receptor, AMHR2, which recruits type I receptors ACVR1 and BMPR1A, subsequently activating the Smad pathway. Structurally, AMH exists as a homodimer, with disulfide linkages contributing to its stability. The diverse functions of AMH underscore its crucial involvement in orchestrating key events in both male and female reproductive development and maintenance.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse Muellerian-inhibiting factor is immobilized at 3 µg/mL(100 µL/well) can bind Recombinant Mouse MISRII. The ED₅₀ for this effect is 64.53 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse Muellerian-inhibiting factor is immobilized at 3 µg/mL(100 µL/well) can bind Recombinant Mouse MISRII. The ED₅₀ for this effect is 64.53 ng/mL.

Mouse

P. pastoris

N-His

P27106 (D450-C552)

11705  [NCBI]

Partial

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Approximately 24 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.