¹⁵N-Labeled IGF2 Protein, Human

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IGF2 (A25-E91)
      Accession # P01344-1
    • C-term
  • Protein Length

    Full Length of IGF2 Chain

  • Synonyms

    ¹⁵N-Insulin-like growth factor 2; ¹⁵N-IGF-II; ¹⁵N-Somatomedin-A; ¹⁵N-Skeletal Growth Factor; ¹⁵N-SGF; IGF2; Insulin-Like Growth Factor 2 (Somatomedin A); Prev. C11orf43; Insulin-Like Growth Factor Type 2; Insulin-Like Growth Factor 2; Somatomedin A; IGF-II; Somatomedin-A; Insulin-Like Growth Factor II; PP9974; T3M-11-Derived Growth Factor; IGF-2; FLJ44734; GRDF; Preptin; SRS3; Insulin Like Growth Factor 2; Chromosome 11 Open Reading Frame 43

  • AA Sequence

    AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

  • Purity

    ≥ 95%, as determined by HPLC.

Product Properties

Appearance

Lyophilized powder

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00