¹⁵N-Labeled IGF2 Protein, Human
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01344-1 (A25-E91)
-
Gene ID3481
-
Molecular Construction
-
N-term
-
IGF2 (A25-E91)
Accession # P01344-1 -
C-term
-
-
Protein Length
Full Length of IGF2 Chain
-
Synonyms
¹⁵N-Insulin-like growth factor 2; ¹⁵N-IGF-II; ¹⁵N-Somatomedin-A; ¹⁵N-Skeletal Growth Factor; ¹⁵N-SGF; IGF2; Insulin-Like Growth Factor 2 (Somatomedin A); Prev. C11orf43; Insulin-Like Growth Factor Type 2; Insulin-Like Growth Factor 2; Somatomedin A; IGF-II; Somatomedin-A; Insulin-Like Growth Factor II; PP9974; T3M-11-Derived Growth Factor; IGF-2; FLJ44734; GRDF; Preptin; SRS3; Insulin Like Growth Factor 2; Chromosome 11 Open Reading Frame 43
-
AA Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
-
Purity
≥ 95%, as determined by HPLC.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)