¹⁵N-Labeled SNCA Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P37840-1 (M1-A140)
-
Gene ID6622
-
Molecular Construction
-
N-term
-
6*His
-
SNCA (M1-A140)
Accession # P37840-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
¹⁵N-Alpha-synuclein; ¹⁵N-α-Synuclein; ¹⁵N-NACP; ¹⁵N-Non-A beta component of AD amyloid; ¹⁵N-Non-A4 component of amyloid precursor; ¹⁵N-PARK1; SNCA; Parkinson Disease (Autosomal Dominant; Lewy Body) 4; Prev. PARK1; Non-A4 Component Of Amyloid Precursor; Prev. PARK4; Non A-Beta Component Of AD Amyloid; Alpha-Synuclein; Non-A Beta Component Of AD Amyloid; NACP; Synuclein Alpha-140; PD1; I+/--Synuclein; Synuclein; Alpha (Non A4 Component Of Amyloid Precursor); Α-Synuclein; Synuclein Alpha; Non A4 Component Of Amyloid Precursor
-
AA Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
