NANS Protein, Human (His)
NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.
Background
NANS protein (sialic acid synthases) is an enzyme that functions in the biosynthetic pathways of sialic acids. Both subfamilies of sialic acid synthases possess N-terminal triosephosphate isomerase barrel domain and C-terminal antifreeze protein domain. Sialic acid synthases uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. However, it exhibits much higher activity toward the Neu5Ac phosphate product. NANS catalyzes the condensation of phosphoenolpyruvate (PEP) with either ManNAc (bacteria) or ManNAc-6P (mammals) to give NeuNAc or NeuNAc-9P, respectively. NANS is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. NANS-mediated sialic acid synthesis has a pivotal role in skeletal development, specifically in growth plate cartilage. NANS mutations impair enzyme activity and lead to accumulation of N-acetylmannosamine in vivo[1][2][3][4].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAH19315.1 (M1-S359)
-
Molecular Construction
-
N-term
-
6*His
-
NANS (M1-S359)
Accession # AAH19315.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NANS; N-Acetylneuraminic Acid Synthase; N-Acetylneuraminate Synthase; Sialic Acid Phosphate Synthase; SAS; Epididymis Secretory Protein Li 100; Sialic Acid Synthase; HEL-S-100; 3-Deoxy-D-Glycero-D-Galacto-Nononate 9-Phosphate Synthase; SEMDCG; N-Acetylneu
-
AA Sequence
MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
-
Predicted Molecular Mass
42.4 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)