1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. NANS Protein, Human (His)

NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.

Background

NANS protein (sialic acid synthases) is an enzyme that functions in the biosynthetic pathways of sialic acids. Both subfamilies of sialic acid synthases possess N-terminal triosephosphate isomerase barrel domain and C-terminal antifreeze protein domain. Sialic acid synthases uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. However, it exhibits much higher activity toward the Neu5Ac phosphate product. NANS catalyzes the condensation of phosphoenolpyruvate (PEP) with either ManNAc (bacteria) or ManNAc-6P (mammals) to give NeuNAc or NeuNAc-9P, respectively. NANS is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. NANS-mediated sialic acid synthesis has a pivotal role in skeletal development, specifically in growth plate cartilage. NANS mutations impair enzyme activity and lead to accumulation of N-acetylmannosamine in vivo[1][2][3][4].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH19315.1 (M1-S359)

Gene ID
Molecular Construction
N-term
6*His
NANS (M1-S359)
Accession # AAH19315.1
C-term
Protein Length

Full Length

Synonyms
Sialic Acid Synthase; N-Acetylneuraminate Synthase; N-Acetylneuraminate-9-Phosphate Synthase; N-Acetylneuraminic Acid Phosphate Synthase; N-Acetylneuraminic Acid Synthase; NANS; SAS
AA Sequence

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

Predicted Molecular Mass
42.4 kDa
분자량

Approximately 42 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

NANS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

NANS Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
NANS Protein, Human (His)
Cat. No.:
HY-P70959
수량:
MCE Japan Authorized Agent: