Nectin-2/CD112 Protein, Cynomolgus (HEK293, His)

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Nectin-2/CD112 (Q32-G360)
      Accession # A0A2K5U084
    • 10*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NECTIN2; Poliovirus Receptor-Related 2 (Herpesvirus Entry Mediator B); Prev. PVRL2; Herpes Virus Entry Mediator B; Prev. HVEB; Herpesvirus Entry Mediator B; Nectin-2; Herpesvirus Entry Protein B; PRR2; Poliovirus Receptor-Like 2; PVRR2; CD112 Antigen; CD1

  • AA Sequence

    QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSQRLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00