1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neuropoietin
  5. Neuropoietin Protein, Mouse

Neurogenin, a protein associated with elevated platelet counts and splenomegaly, is involved in neuronal precursor development and maturation. By binding to the CNTF receptor complex (including CNTF alpha chain, LIFR and IL6ST), neurogenin may affect signaling pathways related to cell differentiation. Neuropoietin Protein, Mouse is the recombinant mouse-derived Neuropoietin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurogenin, a protein associated with elevated platelet counts and splenomegaly, is involved in neuronal precursor development and maturation. By binding to the CNTF receptor complex (including CNTF alpha chain, LIFR and IL6ST), neurogenin may affect signaling pathways related to cell differentiation. Neuropoietin Protein, Mouse is the recombinant mouse-derived Neuropoietin protein, expressed by E. coli , with tag free.

Background

Neuropoietin, a protein associated with increased platelet count and splenomegaly, potentially plays a crucial role in neuronal precursor development and maturation. It exerts its effects by binding to the tripartite CNTF receptor complex, which comprises the CNTF alpha chain, LIFR, and IL6ST. This interaction, observed in vitro, suggests Neuropoietin's involvement in signaling pathways associated with cellular differentiation and maturation processes. The protein's dual roles in platelet regulation and neurodevelopment underscore its versatility and potential significance in diverse physiological contexts.

Biological Activity

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 50-200 ng/mL.

  • Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 92.96 ng/mL.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P83714 (A23-A204)

Gene ID

244218  [NCBI]

Molecular Construction
N-term
Neuropoietin (A23-A204)
Accession # P83714
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cardiotrophin-2; Ctf2; CT-2; Neuropoietin; Np; Gm494
AA Sequence

APISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA

Predicted Molecular Mass
19.7 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Neuropoietin Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Neuropoietin Protein, Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropoietin Protein, Mouse
Cat. No.:
HY-P79121
Quantity:
MCE Japan Authorized Agent: