Copy Link Print Information

Neuropoietin Protein, Mouse

Customer Review

Based on 1 Customer Validation

Neurogenin, a protein associated with elevated platelet counts and splenomegaly, is involved in neuronal precursor development and maturation. By binding to the CNTF receptor complex (including CNTF alpha chain, LIFR and IL6ST), neurogenin may affect signaling pathways related to cell differentiation. Neuropoietin Protein, Mouse is the recombinant mouse-derived Neuropoietin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Neuropoietin Protein, Mouse
  • Experimental Validation Results for Neuropoietin Protein, Mouse
  • Neuropoietin Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Neurogenin, a protein associated with elevated platelet counts and splenomegaly, is involved in neuronal precursor development and maturation. By binding to the CNTF receptor complex (including CNTF alpha chain, LIFR and IL6ST), neurogenin may affect signaling pathways related to cell differentiation. Neuropoietin Protein, Mouse is the recombinant mouse-derived Neuropoietin protein, expressed by E. coli , with tag free.

Background

Neuropoietin, a protein associated with increased platelet count and splenomegaly, potentially plays a crucial role in neuronal precursor development and maturation. It exerts its effects by binding to the tripartite CNTF receptor complex, which comprises the CNTF alpha chain, LIFR, and IL6ST. This interaction, observed in vitro, suggests Neuropoietin's involvement in signaling pathways associated with cellular differentiation and maturation processes. The protein's dual roles in platelet regulation and neurodevelopment underscore its versatility and potential significance in diverse physiological contexts.

Verified Bioactivity

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 50-200 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 92.96 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P83714 (A23-A204)

  • Gene ID
    244218  [NCBI]
  • Molecular Construction
    • N-term
    • Neuropoietin (A23-A204)
      Accession # P83714
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CEBPZ; CTF2; CCAAT Enhancer Binding Protein Zeta; CBF; CBF2; CCAAT/Enhancer Binding Proteincebp* Family Zeta; HSP-CBF; CCAAT/Enhancer Binding Protein Cebp Family Zeta; CCAAT/Enhancer Binding Protein (C/EBP), Zeta; CCAAT/Enhancer Binding Protein Zeta; CCAA

  • AA Sequence

    APISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA

  • Predicted Molecular Mass

    19.7 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 92.96 ng/mL.

  • Neuropoietin Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for Neuropoietin Protein, Mouse
  • Experimental Validation Results for Neuropoietin Protein, Mouse
  • Neuropoietin Protein, Mouse Product Image