Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc)
Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by inhibiting the release of acetylcholine in the nervous system. As the precursor of botulinum neurotoxin E, it uses polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc) is the recombinant Neurotoxin Type E Light Chain protein, expressed by E. coli , with N-His labeled and C-Myc labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by inhibiting the release of acetylcholine in the nervous system. As the precursor of botulinum neurotoxin E, it uses polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc) is the recombinant Neurotoxin Type E Light Chain protein, expressed by E. coli , with N-His labeled and C-Myc labeled tag.
Background
Neurotoxin Type E Light Chain Protein, a component of botulinum toxin, induces flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from the presynaptic membranes of nerve terminals in the skeletal and autonomic nervous systems of eukaryotic hosts, often resulting in heart or respiratory failure. As a precursor of botulinum neurotoxin E, it engages two coreceptors—complex polysialylated gangliosides on neural tissue and specific membrane-anchored proteins in synaptic vesicles. Receptor proteins become exposed on the host's presynaptic cell membrane during neurotransmitter release, initiating binding with the toxin's heavy chain (HC). Following endocytic uptake and a pH-dependent structural rearrangement, the HC's N-terminus forms pores, facilitating the translocation of the light chain (LC) into the cytosol. Once in the cytosol, the disulfide bond between the subunits is reduced, allowing LC to cleave its target protein on synaptic vesicles, preventing their fusion with the cytoplasmic membrane and thus blocking neurotransmitter release. The proteolytic activity of LC, specifically hydrolyzing the '180-Arg-|-Ile-181' bond in SNAP25, is essential for its inhibitory effect on neurotransmission.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag C-Myc;N-6*His
-
Accession
Q00496 (P2-R422)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
botE (P2-R422)
Accession # Q00496 -
Myc
-
C-term
-
-
Protein Length
Full Length of Botulinum neurotoxin E light Chain
-
Synonyms
Botulinum neurotoxin type E; BoNT/E; Bontoxilysin-E; Botulinum neurotoxin E light chain (LC); EC:3.4.24.69; Botulinum neurotoxin E heavy chain (HC); botE
-
AA Sequence
PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGSIAIVTFSPEYSFRFNDNCMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLRTKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR
-
Predicted Molecular Mass
53.5 kDa
-
Molecular Weight
Approximately 54 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)