Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc)

Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by inhibiting the release of acetylcholine in the nervous system. As the precursor of botulinum neurotoxin E, it uses polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc) is the recombinant Neurotoxin Type E Light Chain protein, expressed by E. coli , with N-His labeled and C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by inhibiting the release of acetylcholine in the nervous system. As the precursor of botulinum neurotoxin E, it uses polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc) is the recombinant Neurotoxin Type E Light Chain protein, expressed by E. coli , with N-His labeled and C-Myc labeled tag.

Background

Neurotoxin Type E Light Chain Protein, a component of botulinum toxin, induces flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from the presynaptic membranes of nerve terminals in the skeletal and autonomic nervous systems of eukaryotic hosts, often resulting in heart or respiratory failure. As a precursor of botulinum neurotoxin E, it engages two coreceptors—complex polysialylated gangliosides on neural tissue and specific membrane-anchored proteins in synaptic vesicles. Receptor proteins become exposed on the host's presynaptic cell membrane during neurotransmitter release, initiating binding with the toxin's heavy chain (HC). Following endocytic uptake and a pH-dependent structural rearrangement, the HC's N-terminus forms pores, facilitating the translocation of the light chain (LC) into the cytosol. Once in the cytosol, the disulfide bond between the subunits is reduced, allowing LC to cleave its target protein on synaptic vesicles, preventing their fusion with the cytoplasmic membrane and thus blocking neurotransmitter release. The proteolytic activity of LC, specifically hydrolyzing the '180-Arg-|-Ile-181' bond in SNAP25, is essential for its inhibitory effect on neurotransmission.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag C-Myc;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • botE (P2-R422)
      Accession # Q00496
    • Myc
    • C-term
  • Protein Length

    Full Length of Botulinum neurotoxin E light Chain

  • Synonyms

    Botulinum neurotoxin type E; BoNT/E; Bontoxilysin-E; Botulinum neurotoxin E light chain (LC); EC:3.4.24.69; Botulinum neurotoxin E heavy chain (HC); botE

  • AA Sequence

    PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGSIAIVTFSPEYSFRFNDNCMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLRTKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR

  • Predicted Molecular Mass

    53.5 kDa

  • Molecular Weight

    Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00