Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc)

Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by inhibiting the release of acetylcholine in the nervous system. As the precursor of botulinum neurotoxin E, it uses polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type E Light Chain Protein, Botulinum (His, Myc) is the recombinant Neurotoxin Type E Light Chain protein, expressed by E. coli , with N-His labeled and C-Myc labeled tag.

Neurotoxin Type E Light Chain Protein, a component of botulinum toxin, induces flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from the presynaptic membranes of nerve terminals in the skeletal and autonomic nervous systems of eukaryotic hosts, often resulting in heart or respiratory failure. As a precursor of botulinum neurotoxin E, it engages two coreceptors—complex polysialylated gangliosides on neural tissue and specific membrane-anchored proteins in synaptic vesicles. Receptor proteins become exposed on the host's presynaptic cell membrane during neurotransmitter release, initiating binding with the toxin's heavy chain (HC). Following endocytic uptake and a pH-dependent structural rearrangement, the HC's N-terminus forms pores, facilitating the translocation of the light chain (LC) into the cytosol. Once in the cytosol, the disulfide bond between the subunits is reduced, allowing LC to cleave its target protein on synaptic vesicles, preventing their fusion with the cytoplasmic membrane and thus blocking neurotransmitter release. The proteolytic activity of LC, specifically hydrolyzing the '180-Arg-|-Ile-181' bond in SNAP25, is essential for its inhibitory effect on neurotransmission.

Others

E. coli

C-Myc;N-6*His

Q00496 (P2-R422)

/

Partial

PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGSIAIVTFSPEYSFRFNDNCMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLRTKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR

Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.