1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Neurotrophin-4 Protein, Human (HEK293)

Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (HEK293) is the recombinant human-derived Neurotrophin-4 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (HEK293) is the recombinant human-derived Neurotrophin-4 protein, expressed by HEK293 , with tag free.

Background

Neurotrophin-4 (NT-4) protein operates as a crucial target-derived survival factor specifically for peripheral sensory sympathetic neurons. Its pivotal role lies in supporting the survival and maintenance of these neurons, emphasizing NT-4's significance in promoting the health and functionality of peripheral sensory sympathetic neurons. The specific and targeted action of NT-4 underscores its role as a neurotrophic factor, playing a key part in the intricate mechanisms that govern the survival and well-being of peripheral neurons within the sympathetic nervous system.

Biological Activity

Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is 2.337 ng/mL, corresponding to a specific activity is 4.279×105 units/mg.

  • Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is 2.337 ng/mL, corresponding to a specific activity is 4.279×105 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P34130 (G81-A210)

Gene ID

4909

Molecular Construction
N-term
Neurotrophin-4 (G81-A210)
Accession # P34130
C-term
Protein Length

Full Length of Mature Protein

Synonyms
GLC10; GLC1O; neurotrophic factor 4; neurotrophic factor 5; neurotrophin 4; neurotrophin-4; neurotrophin-5; Neutrophic factor 4; NT4; NT-4; NT-4/5; NT-5; NTF4; NTF5; NTF5NT5
AA Sequence

GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Predicted Molecular Mass
13.9 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 20% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Neurotrophin-4 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Neurotrophin-4 Protein, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neurotrophin-4 Protein, Human (HEK293)
Cat. No.:
HY-P702537
Quantity:
MCE Japan Authorized Agent: