NKG2C/CD159c Protein, Human (HEK293, His)

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Human (HEK293, His) is the recombinant human-derived NKG2C/CD159c protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Human (HEK293, His) is the recombinant human-derived NKG2C/CD159c protein, expressed by HEK293, with N-His labeled tag.

Background

NKG2C/CD159c Protein, an immune activating receptor, plays a pivotal role in self-nonself discrimination. Teaming up with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules. This interaction likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and is implicated in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infection. Upon binding to HLA-E-peptide complexes, NKG2C/CD159c transmits intracellular signals through the adapter protein TYROBP/DAP12, initiating the phosphorylation of proximal signaling molecules and subsequent cell activation. Forming a heterodimer with KLRD1 through disulfide linkage, the KLRD1-KLRC2 receptor complex, in association with TYROBP homodimers, is crucial for its cell surface expression. Additionally, this receptor complex can bind with low affinity to HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia. The multifaceted interactions and functions of NKG2C/CD159c underscore its essential role in immune responses and self-tolerance mechanisms.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • NKG2C (I94-L231)
      Accession # P26717
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KLRC2; NK Cell Receptor C; Killer Cell Lectin Like Receptor C2; NKG2-C; NKG2-C Type II Integral Membrane Protein; CD159c; NKG2C; Killer Cell Lectin-Like Receptor Subfamily C, Member 2; CD159 Antigen-Like Family Member C; Natural Killer Cell Receptor G2-C;

  • AA Sequence

    IPFLEQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

  • Predicted Molecular Mass

    17.8 kDa

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00