1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. NKG2C/CD159c
  5. NKG2C/CD159c Protein, Human (HEK293, His)

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Human (HEK293, His) is the recombinant human-derived NKG2C/CD159c protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Human (HEK293, His) is the recombinant human-derived NKG2C/CD159c protein, expressed by HEK293, with N-His labeled tag.

Background

NKG2C/CD159c Protein, an immune activating receptor, plays a pivotal role in self-nonself discrimination. Teaming up with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules. This interaction likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and is implicated in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infection. Upon binding to HLA-E-peptide complexes, NKG2C/CD159c transmits intracellular signals through the adapter protein TYROBP/DAP12, initiating the phosphorylation of proximal signaling molecules and subsequent cell activation. Forming a heterodimer with KLRD1 through disulfide linkage, the KLRD1-KLRC2 receptor complex, in association with TYROBP homodimers, is crucial for its cell surface expression. Additionally, this receptor complex can bind with low affinity to HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia. The multifaceted interactions and functions of NKG2C/CD159c underscore its essential role in immune responses and self-tolerance mechanisms.

Species

Human

Source

HEK293

Tag

N-His

Accession

P26717 (I94-L231)

Gene ID

3822

Molecular Construction
N-term
His
NKG2C (I94-L231)
Accession # P26717
C-term
Protein Length

Extracellular Domain

Synonyms
CD159c; KLRC2; NKG2C; NK cell receptor C
AA Sequence

IPFLEQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Predicted Molecular Mass
17.8 kDa.
Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKG2C/CD159c Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKG2C/CD159c Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2C/CD159c Protein, Human (HEK293, His)
Cat. No.:
HY-P704818
Quantity:
MCE Japan Authorized Agent: