NKG2D/CD314 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells. It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8(+) T cell-mediated adaptive responses. NKG2D/CD314 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells. It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8(+) T cell-mediated adaptive responses. NKG2D/CD314 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.
Background
NKG2D/CD314 protein operates as an activating and costimulatory receptor essential for immunosurveillance, binding to diverse cellular stress-inducible ligands presented on autologous tumor cells and virus-infected cells. It plays a dual role in innate immune responses, stimulating both activating killer (NK) cells and acting as a costimulatory receptor for T-cell receptors (TCR) in CD8(+) T-cell-mediated adaptive immune responses, enhancing T-cell activation. The receptor facilitates perforin-mediated elimination of ligand-expressing tumor cells, and its signaling cascades involve calcium influx, ultimately leading to TNF-alpha expression. Additionally, NKG2D/CD314 participates in NK cell-mediated bone marrow graft rejection and may regulate the differentiation and survival of NK cells. Its ligand-binding capacity extends to various subfamilies of MHC class I-related glycoproteins, including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3), and ULBP4. The protein forms homodimers through disulfide linkage and heterohexamers with HCST/DAP10 subunits, a crucial interaction for NK cell surface expression and cytotoxicity induction. Furthermore, it can establish disulfide-bonded heterodimers with CD94 and interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation, while not interacting with TYROBP.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When immobilized Biotinylated Human NKG2D His at 1 μg/mL (100μL/Well), Anti-NKG2D Antibody hFc binds with an EC50 of 4.4 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-8*His
-
Accession
P26718 (F78-V216)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
NKG2D (F78-V216)
Accession # P26718 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
KLRK1; CD314; Prev. D12S2489E; Killer Cell Lectin-Like Receptor Subfamily K, Member 1; NKG2D; NKG2-D-Activating NK Receptor; NKG2-D Type II Integral Membrane Protein; DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence; NK Cell Receptor D; Kille
-
AA Sequence
FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 36-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)