NOSIP Protein, Human
NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human is the recombinant human-derived NOSIP protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human is the recombinant human-derived NOSIP protein, expressed by E. coli , with tag free.
NOSIP is a crucial E3 ubiquitin-protein ligase essential for proper development of the forebrain, eye, and face. It plays a pivotal role in cellular processes by catalyzing the monoubiquitination of the serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB. Moreover, NOSIP serves as a negative regulator of nitric oxide production by inducing the translocation of NOS1 and NOS3 to the actin cytoskeleton, ultimately inhibiting their enzymatic activity. This dual functionality highlights the significance of NOSIP in both developmental processes and the regulation of nitric oxide signaling, underscoring its versatile role in cellular homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y314 (T2-A301)
-
Gene ID51070
-
Molecular Construction
-
N-term
-
NOSIP (T2-A301)
Accession # Q9Y314 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NOSIP; Nitric oxide synthase-interacting protein; E3 ubiquitin-protein ligase NOSIP; RING-type E3 ubiquitin transferase NOSIP; eNOS-interacting protein
-
AA Sequence
TRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
