NOSIP Protein, Human

NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human is the recombinant human-derived NOSIP protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human is the recombinant human-derived NOSIP protein, expressed by E. coli , with tag free.

Background

NOSIP is a crucial E3 ubiquitin-protein ligase essential for proper development of the forebrain, eye, and face. It plays a pivotal role in cellular processes by catalyzing the monoubiquitination of the serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB. Moreover, NOSIP serves as a negative regulator of nitric oxide production by inducing the translocation of NOS1 and NOS3 to the actin cytoskeleton, ultimately inhibiting their enzymatic activity. This dual functionality highlights the significance of NOSIP in both developmental processes and the regulation of nitric oxide signaling, underscoring its versatile role in cellular homeostasis.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NOSIP (T2-A301)
      Accession # Q9Y314
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    NOSIP; E3 Ubiquitin-Protein Ligase NOSIP; Nitric Oxide Synthase Interacting Protein; CGI-25; Nitric Oxide Synthase-Interacting Protein; ENOS-Interacting Protein; RING-Type E3 Ubiquitin Transferase NOSIP

  • AA Sequence

    TRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00