NOSIP Protein, Human

NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human is the recombinant human-derived NOSIP protein, expressed by E. coli , with tag free.

NOSIP is a crucial E3 ubiquitin-protein ligase essential for proper development of the forebrain, eye, and face. It plays a pivotal role in cellular processes by catalyzing the monoubiquitination of the serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB. Moreover, NOSIP serves as a negative regulator of nitric oxide production by inducing the translocation of NOS1 and NOS3 to the actin cytoskeleton, ultimately inhibiting their enzymatic activity. This dual functionality highlights the significance of NOSIP in both developmental processes and the regulation of nitric oxide signaling, underscoring its versatile role in cellular homeostasis.

Human

E. coli

Tag Free

Q9Y314 (T2-A301)

51070

Partial

TRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.