1. Recombinant Proteins
  2. Receptor Proteins
  3. Notch family
  4. Notch-3
  5. Notch 3 Protein, Human (HEK293, C-His-Avi)

Notch 3 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and plays a crucial regulatory role in cell fate determination. Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes within the enhancer of the cleavage site. Notch 3 Protein, Human (HEK293, C-His-Avi) is the recombinant human-derived Notch 3 protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
20 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Notch 3 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and plays a crucial regulatory role in cell fate determination. Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes within the enhancer of the cleavage site. Notch 3 Protein, Human (HEK293, C-His-Avi) is the recombinant human-derived Notch 3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Notch 3 protein serves as a receptor for membrane-bound ligands, including Jagged1, Jagged2, and Delta1, playing a pivotal role in regulating cell-fate determination. Upon ligand activation, the released notch intracellular domain (NICD) forms a transcriptional activator complex with RBPJ/RBPSUH, initiating the activation of genes within the enhancer of split locus. This multifaceted protein influences cellular differentiation, proliferation, and apoptotic programs. Structurally, it exists as a heterodimer composed of a C-terminal fragment (N(TM)) and a N-terminal fragment (N(EC)), likely linked by disulfide bonds. Notch 3 interacts with transcriptional coactivators MAML1, MAML2, and MAML3, modulating downstream transcriptional processes. It also engages with PSMA1 and HIF1AN, contributing to diverse cellular functions and regulatory pathways.

Actividad biológica

Immobilized Human Notch 3, His Tag at 2μg/ml (100μl/Well) on the plate. Dose response curve for Anti-Notch 3 Antibody, hFc Tag with the EC50 of 5.7 ng/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

C-8*His

Accession

Q9UM47 (A1378-S1640)

Gene ID
Molecular Construction
N-term
Notch 3 (A1378-S1640)
Accession # Q9UM47
8*His
C-term
Protein Length

Partial

Synonyms
CADASIL; Notch homolog 3; Notch-3; NOTCH3
AA Sequence

APEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPS

Predicted Molecular Mass
30.2 kDa
Peso molecular

Approximately 27-30 kDa & 10-12 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Notch 3 Protein, Human (HEK293, C-His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Notch 3 Protein, Human (HEK293, C-His-Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Notch 3 Protein, Human (HEK293, C-His-Avi)
Cat. No.:
HY-P700804
Cantidad:
MCE Japan Authorized Agent: