Copy Link Print Information

Notch 3 Protein, Human (HEK293, C-His-Avi)

Customer Review

Based on 1 Customer Validation

Notch 3 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and plays a crucial regulatory role in cell fate determination. Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes within the enhancer of the cleavage site. Notch 3 Protein, Human (HEK293, C-His-Avi) is the recombinant human-derived Notch 3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Notch 3 Protein, Human (HEK293, C-His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Notch 3 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and plays a crucial regulatory role in cell fate determination. Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes within the enhancer of the cleavage site. Notch 3 Protein, Human (HEK293, C-His-Avi) is the recombinant human-derived Notch 3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Notch 3 protein serves as a receptor for membrane-bound ligands, including Jagged1, Jagged2, and Delta1, playing a pivotal role in regulating cell-fate determination. Upon ligand activation, the released notch intracellular domain (NICD) forms a transcriptional activator complex with RBPJ/RBPSUH, initiating the activation of genes within the enhancer of split locus. This multifaceted protein influences cellular differentiation, proliferation, and apoptotic programs. Structurally, it exists as a heterodimer composed of a C-terminal fragment (N(TM)) and a N-terminal fragment (N(EC)), likely linked by disulfide bonds. Notch 3 interacts with transcriptional coactivators MAML1, MAML2, and MAML3, modulating downstream transcriptional processes. It also engages with PSMA1 and HIF1AN, contributing to diverse cellular functions and regulatory pathways.

Verified Bioactivity

Immobilized Human Notch 3, His Tag at 2μg/ml (100μl/Well) on the plate. Dose response curve for Anti-Notch 3 Antibody, hFc Tag with the EC50 of 5.7 ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession

    Q9UM47 (A1378-S1640)

  • Gene ID
    4854  [NCBI]
  • Molecular Construction
    • N-term
    • Notch 3 (A1378-S1640)
      Accession # Q9UM47
    • 8*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    NOTCH3; Notch 3-Like Protein; Prev. CADASIL; CADASIL1; Notch 3; CARASIL1; CASIL; FPLD1; Neurogenic Locus Notch Homolog Protein 3; IMF2; Notch (Drosophila) Homolog 3; LMNS; Notch Homolog 3 (Drosophila); Notch Receptor 3; Notch Homolog 3

  • AA Sequence

    APEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPS

  • Predicted Molecular Mass

    30.2 kDa

  • Molecular Weight

    Approximately 27-30 kDa & 10-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Notch 3 Protein, Human (HEK293, C-His-Avi) Product Image
    1/16
  • Notch 3 Protein, Human (HEK293, C-His-Avi) Product Image