NRG1-beta 1 Protein, Human (CHO)
Based on 1 Customer Validation
HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 1 Protein, Human (CHO) is the recombinant human-derived NRG1-beta 1 protein, expressed by CHO , with tag free.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 1 Protein, Human (CHO) is the recombinant human-derived NRG1-beta 1 protein, expressed by CHO , with tag free.
Background
HRG1-β1 activates HER2/HER3 signaling and up-regulate Fn14 gene expression in parental MCF7 cells. HRG1-β1-mediated Fn14 up-regulation in MCF7/HER2-18 cells is required for maximal MMP-9 production.
Verified Bioactivity
ED50 ≤ 0.5 ng/mL, determined by the dose-dependent stimulation of the proliferation of human MCF-7 cells.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
Q02297-6 (T176-K246)
-
Molecular Construction
-
N-term
-
NRG1-beta 1 (T176-K246)
Accession # Q02297-6 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
NRG1; NRG1 Class VII Isoform Alpha 2a; Prev. HGL; NRG1 Class VII Isoform Beta 2a; Prev. NRG1-IT2; Neuregulin 1 Isoform HRG-Gamma; NDF; Neuregulin 1 Isoform HRG-Beta3; GGF; Neuregulin 1 Isoform HRG-Beta2; Pro-Neuregulin-1, Membrane-Bound Isoform; Neureguli
-
AA Sequence
TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)