NTRK2 Protein, Human (Active, sf9, His-GST)
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-6*His;N-GST
-
Accession
Q16620-1 (L456-G822)
-
Gene ID4915
-
Molecular Construction
-
N-term
-
6*His-GST
-
NTRK2 (L456-G822)
Accession # Q16620-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
NTRK2; Neurotrophic Tyrosine Kinase, Receptor, Type 2, Isoform CRA_a; Neurotrophic Receptor Tyrosine Kinase 2; Neurotrophic Tyrosine Kinase, Receptor, Type 2; TRKB; Neurotrophin Receptor Tyrosine Kinase Type 2; BDNF/NT-3 Growth Factors Receptor; BDNF-Trop
-
AA Sequence
LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
-
Predicted Molecular Mass
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
